Recombinant Human Urokinase-Type Plasminogen Activator (PLAU) Protein (His)

Name: Recombinant Human Urokinase-Type Plasminogen Activator (PLAU) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08286P
Price: 418.4 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Antibody / cell therapy targets, Car-t cell therapy targets, Recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Urokinase-Type Plasminogen Activator (PLAU) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P00749
Target Symbol	PLAU
Synonyms	ATF; ATF uPA; BDPLT5; Plasminogen activator; Plasminogen activator urinary; Plasminogen activator urokinase; PLAU; QPD; u PA; U plasminogen activator; u-PA; U-plasminogen activator; uPA; URK; UROK_HUMAN; Urokinase plasminogen activator; Urokinase type plasminogen activator; Urokinase type plasminogen activator precursor; Urokinase-type plasminogen activator chain B
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTL
Expression Range	21-173aa
Protein Length	Partial
Mol. Weight	21.3kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Subcellular Location	Secreted.
Protein Families	Peptidase S1 family
Database References	HGNC: 9052 OMIM: 191840 KEGG: hsa:5328 STRING: 9606.ENSP00000361850 UniGene: Hs.77274
Associated Diseases	Quebec platelet disorder (QPD)
Tissue Specificity	Expressed in the prostate gland and prostate cancers.

Gene Functions References

The combination of decoy receptor 3, soluble urokinase type plasminogen activator receptor, and procalcitonin improved the sensitivity and specificity of diagnosis of sepsis, suggesting that use of the combination of three indexes enhanced the efficiency of sepsis diagnosis. PMID: 29760745
High Expressions of PLAU is associated with lung adenocarcinoma. PMID: 28454121
Increased expression of uPA in epidermal cells in psoriasis and in tumor cells in basal cell carcinomas suggests an important role of the uPA system for aggressively proliferating and invading cells of epidermal origin. PMID: 28429105
study provides strong support in the role of L. reuteri in suppression of GC cell invasion by downregulation of pathways which is involved in extracellular matrix degradation such as uPA and uPAR PMID: 28643742
Gelsolin enhances the invasive capacity of colon cancer cells via elevating intracellular superoxide (O2.-) levels by interacting with Cu/ZnSOD, and gelsolin gene expression positively correlates with urokinase plasminogen activator (uPA), an important matrix-degrading protease invovled in cancer invasion. PMID: 27391159
Study provides evidence that the stimulation of u-PA/u-PAR system contributes to the activated phenotype and function of cancer-associated fibroblasts during multiple myeloma. PMID: 28340565
OB-Rb, RhoA/ROCK, PI3K/AKT, JAK/STAT pathways and NF-kB activation are involved in leptin-induced upA expression. PMID: 28104444
Results provide evidence that uPA and IGF1R directly interact with uPAR enhancing malignant potential of triple-negative breast cancer. PMID: 27502396
suggest that the low endogenous levels of uPA in blood are actively regulated, and that the regulatory mechanisms are disrupted in QPD in a megakaryocyte-specific manner PMID: 28301587
an intricate link between caveolin-1 and Src kinase-mediated cell signaling and alveolar epithelial cell apoptosis due to loss of SP-C expression through p53 and uPA system-mediated cross-talk, is reported. PMID: 28385810
results show that the uPA/uPAR/LRP1 system is a potential target for the development of therapeutic strategies to promote axonal recovery following a CNS injury PMID: 27986809
The present research concluded that aspirin suppressed prostate cancer cell invasion by reducing MMP-9 activity and uPA expression through decreasing of IKK-beta-mediated NF-kappaB activation, indicating that the ability of aspirin to inhibit cell invasion might be useful in the chemoprevention of metastatic prostate cancer. PMID: 28278500
These studies identify uPA-dependent de-repression of vegfr1 and vegfr2 gene transcription through binding to HHEX/PRH as a novel mechanism by which uPA mediates the pro-angiogenic effects of VEGF and identifies a potential new target for control of pathologic angiogenesis. PMID: 27151212
The up-regulation of uPA mRNAs was correlated with high-risk clinicopathological features, including extrathyroid invasion, loss of cellular polarity/cohesiveness, and the BRAF(V600E) mutation. PMID: 25085839
Transplantation of uPA gene modified mesenchymal stem cells suppressed liver fibrosis and ameliorated liver function and may be a new approach to treating liver fibrosis PMID: 26877613
ApaL1 and Taq1 single nucleotide polymorphisms of the urokinase and VDR genes are associated with recurrent urolithiasis in a Caucasian population. PMID: 26275878
Resveratrol inhibited hypoxia-induced HIF-1alpha protein expression. Resveratrol also suppressed hypoxiainduced expression of metastatic-related factors, uPA and MMP2. PMID: 26707376
Significance of the urokinase-type plasminogen activator and its receptor in the progression of focal segmental glomerulosclerosis in clinical and mouse models. PMID: 26846181
Data suggest that enhanced levels of uPA in breast cancer modulate the mitogenic effects of EGF which helps to better understand breast cancer pathogenesis. PMID: 25641046
Results found high levels of uPA and uPAR exclusively in metastatic osteosarcoma (OS)cells and suggest that malignant conversion of OS cells to uPA/uPAR axis in an autocrine and paracrine fashion. PMID: 26317203
The morphologically normal tissue adjacent to the tumor shows the substantial expression of MMP-2 and MMP-9 and in some cases the enhanced activity of uPA and ACE, which makes an additional contribution to the increased invasive potential of tumor PMID: 26978018
it was found that the recombinant fusion protein uPA17-34-KPI(kunitz-type protease inhibitor ) inhibited the invasion and metastasis of ovarian tumors PMID: 26166362
Crystal structure of uPA bound with cyclic peptidic inhibitors. PMID: 25744057
u-PA is a dysregulated gene involved in the tumorigenesis, bio-pathological features and outcomes of EEC. PMID: 26033187
High cytoplasmic expression of uPA is associated with cells of rectal cancer and metastases of perienteric lymph nodes. PMID: 26504024
DIM can influence the cell migratory and invasive properties of human colorectal cancer cells and may decrease the invasive capacity of colorectal cancer through downregulation of uPA and MMP9 mediated by suppression of the transcription factor FOXM1 PMID: 25962429
Porphyromonas gingivalis-derived RgpA-Kgp complex activates the macrophage uPA. PMID: 25979345
SNP P141L associated with collateral circulation in coronary artery disease PMID: 24952395
Taking uPA(1-43) amino acids specifically binding to uPAR as targeted part of fusion protein, and making use of antitumor activity of melittin, the recombinant fusion protein it was able to inhibit growth of ovarian tumors . PMID: 25394558
uPA/uPAR stimulates triglyceride synthesis in Huh7 hepatoma cells via p38-dependent upregulation of DGAT2 PMID: 25244504
Studied urokinase-type plasminogen activator regulation in cigarette smoke extract (CSE)-induced EMT in human small airway epithelial cell lines (HSAEpiCs)and in the small airway epithelium of COPD patients. PMID: 25706093
Silencing of ETV4 suppresses invasion of prostate cancer cells by inhibiting the expression of uPA/uPAR as well as (MMP)-2 and MMP-9 PMID: 25544710
miR-193b inhibits the expression of stathmin 1 (STMN1) and urokinase-type plasminogen activator (uPA) in Panc-1 cells. PMID: 25215905
Activation of uPA and MMP-3 in perifocal zone of the tumor can serve as an indexof its invasive activity. PMID: 25993872
These data support the hypothesis that uPA upregulation stimulated by macrophages may play an active role in the onset of osteoarthritis and in the shear-stress protection against this induction. PMID: 23597113
High preprocedural plasma uPA and serum CRP levels are indicative of angina recurrence after successful PTCA, and are valuable for the prognosis of restenosis. PMID: 24057344
Data indicate that urokinase-type plasminogen activator (uPA) activates epithelial sodium channel, gamma subunit (ENaC gamma) through catalytic activity-dependent proteolytic modification. PMID: 25555911
IL-17 may act as chemotropic factor for peripheral blood-Mesenchymal stem cellss by incrementing cell motility and uPA expression during inflammation development. PMID: 25433194
Suggest a possible protective effect of podocyte uPA/uPAR expression against interstitial fibrosis in IgA nephritis. PMID: 24648800
High u-PA expression is associated with metastasis in breast cancer. PMID: 24610082
In human coronary vascular smooth muscle, uPA induces uPAR-independent, domain-dependent smooth muscle cell proliferation through transactivation of EGFR by a plasmin-mediated, ADAM-induced, and HB-EGF-dependent process. PMID: 25082749
IL-33 is involved in u-PA-driven angiogenesis, a process that has been shown before to be linked to inflammation in various pathologies. PMID: 24702774
IL-1beta-induced urokinase plasminogen activator expression via activation of the ERK1/2 and NF-kappaB pathways, which results in invasion of gastric cancer cells. PMID: 24626561
Studied the relationship between uPA gene polymorphisms and clinical manifestations of idiopathic membranous nephropathy. PMID: 24822208
These effects were mediated by the efficient conversion of pro-uPA to active uPA and high phosphorylation levels of ERK detected in the PANC-1 cells expressing exogenous polyserase-1. PMID: 24756697
We found no association between allele frequency and risk of multiples sclerosis for any single nucleotide polymorphism investigated for PLAU PMID: 23897640
results of this study suggest that uPA decreases the removal of HDL-cholesteryl ester in the liver via suppression of the hepatic scavenger receptor class B type I (SR-BI)expression PMID: 24529115
Oncogenic K-Ras and loss of Smad4 mediate invasion by activating an EGFR/NF-kappaB Axis that induces expression of MMP9 and uPA in human pancreas progenitor cells. PMID: 24340014
The findings provide evidence that the rs2227564 C/T SNP in the u-PA gene is associated with the development of oral tongue squamous cell carcinoma. PMID: 23621237
Decreasing uPA levels sensitized cancer cells to TRAIL, leading to markedly increased apoptosis. PMID: 24481457

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.