Recombinant Human Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09786P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09786P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Urokinase Plasminogen Activator Surface Receptor (PLAUR) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q03405 |
Target Symbol | PLAUR |
Synonyms | CD 87; CD87; CD87 antigen; MO 3; MO3; Monocyte activation antigen Mo3; Plasminogen activator receptor urokinase; Plasminogen activator urokinase receptor; PLAUR; U PAR; u plasminogen activator receptor; U-PAR; u-plasminogen activator receptor form 2; UPA receptor; uPAR; UPAR_HUMAN; Urinary plasminogen activator receptor; URKR; Urokinase plasminogen activator receptor; Urokinase plasminogen activator surface receptor; urokinase-type plasminogen activator (uPA) receptor |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSG |
Expression Range | 23-305aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 58.5kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form. |
Subcellular Location | Cell membrane. Cell projection, invadopodium membrane.; [Isoform 1]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 2]: Secreted. |
Database References | HGNC: 9053 OMIM: 173391 KEGG: hsa:5329 STRING: 9606.ENSP00000339328 UniGene: PMID: 29783959 |