Recombinant Human Urocortin-3 (UCN3) Protein (His-KSI)

Name: Recombinant Human Urocortin-3 (UCN3) Protein (His-KSI)
Brand: Beta LifeScience
SKU: BLC-06930P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Urocortin-3 (UCN3) Protein (His-KSI) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q969E3
Target Symbol	UCN3
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-KSI
Target Protein Sequence	KFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
Expression Range	119-161aa
Protein Length	Full Length of Mature Protein
Mol. Weight	20.1 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
Subcellular Location	Secreted.
Protein Families	Sauvagine/corticotropin-releasing factor/urotensin I family
Database References	HGNC: 17781 OMIM: 605901 KEGG: hsa:114131 STRING: 9606.ENSP00000369798 UniGene: Hs.511775

Gene Functions References

Antiamnesic properties of analogs and mimetics of the tripeptide human urocortin 3 PMID: 27262310
In summary, cardiac expression of CRFR1, CRF, and Ucn3 genes is elevated in heart failure and may contribute to the activation of the CRF/Ucn system in these patients. PMID: 27754786
circulating levels elevated and positively correlated with C-reactive protein in polycystic ovary syndrome PMID: 26488073
results show that activation of CRH receptors by CRH ligands stimulates VEGF-A expression in intestinal epithelial cells through the cAMP/CREB pathway PMID: 26350463
The paracrine actions of Ucn3 activate a negative feedback loop that promotes somatostatin release to ensure the timely reduction of insulin secretion upon normalization of plasma glucose. PMID: 26076035
The molecular modifications of urocortin 3[36-38] led to an improved understanding of the relationship between molecular structure and biological activity of this peptide, could be further tested for possible clinical treatment of depression PMID: 25304878
Data suggest that UCN3 expression can serve as a late stage maturation/differentiation marker in beta-cells during pancreogenesis. [REVIEW] PMID: 25148370
SCP inhibits a subpopulation of PVN neurons, especially OTergic magnocellular neurons, by enhancing the activity of GIRK channels via CRF-R2 PMID: 23349753
study showed that Ucn2 and Ucn3 differentially regulate the LPS-induced TNF-alpha and IL-10 expression and secretion in trophoblast explants acting through CRH-R2. Ucn3 has an anti-inflammatory effect. PMID: 22000474
CRH-R1:CRH-R2 ratio varied according to fat-depot type; whereas CRH-R1 expression was higher in sc fat than in visceral fat, the opposite was true for CRH-R2. PMID: 14764822
Expression of Ucn III/SCP in the human heart and kidney as well as brain and pituitary tissues and its presence in plasma and urine. Ucn III/SCP may therefore regulate the cardiac and renal function as a local factor and a circulating hormone. PMID: 15070962
Ucn 3 plays some physiological or pathological roles in the modulation of gastrointestinal functions during stressful conditions. PMID: 15949638
Ucn3 is produced in the normal adrenal gland and in adrenal tumors (both adrenocortical tumors and pheochromocytomas) and acts as an autocrine or paracrine regulator in both the normal and cancerous adrenal gland tissue. PMID: 16095756
the SCP/CRHR2 system is present in human ovaries and treatment with SCP/Ucn3 inhibits progesterone production by cultured granulosa-lutein cells through interaction with CRHR2 PMID: 19351656

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.