Recombinant Human Upf0568 Protein C14Orf166 (RTRAF) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08644P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Upf0568 Protein C14Orf166 (RTRAF) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08644P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Upf0568 Protein C14Orf166 (RTRAF) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9Y224 |
Target Symbol | RTRAF |
Synonyms | C14orf166; CGI 99; CGI-99; CGI99; Chromosome 14 open reading frame 166; CLE; CLE7; CN166_HUMAN; Homeobox prox 1; LCRP369; RLL motif containing 1; RLLM1; UPF0568 protein C14orf166 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR |
Expression Range | 1-244aa |
Protein Length | Full Length |
Mol. Weight | 55.1kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport.; (Microbial infection) In case of infection by influenza virus A (IVA), is involved in viral replication. |
Subcellular Location | Nucleus. Cytoplasm, cytosol. Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.; Nucleus. Cytoplasm. |
Protein Families | RTRAF family |
Database References | HGNC: 23169 OMIM: 610858 KEGG: hsa:51637 STRING: 9606.ENSP00000261700 UniGene: PMID: 26219895 |