Recombinant Human Uncharacterized Protein Kiaa1377 (CEP126) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09570P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Uncharacterized Protein Kiaa1377 (CEP126) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09570P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Uncharacterized Protein Kiaa1377 (CEP126) Protein (His-SUMO) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9P2H0 |
Target Symbol | CEP126 |
Synonyms | CEP126; KIAA1377; Centrosomal protein of 126 kDa |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His-SUMO |
Target Protein Sequence | HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG |
Expression Range | 559-670aa |
Protein Length | Partial |
Mol. Weight | 28.9kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Participates in cytokinesis. Necessary for microtubules and mitotic spindle organization. Involved in primary cilium formation. |
Subcellular Location | Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, cilium basal body. |
Database References | |
Tissue Specificity | Expressed in brain, lung, skeletal muscle, kidney, pancreas, testis and ovary. |
Gene Functions References
- CEP126 is a regulator of microtubule organisation at the centrosome that acts through modulation of the transport of pericentriolar satellites, and consequently, of the organisation of cell structure PMID: 24867236
- KIAA1377 and C5orf42 gene synergistically play a role as susceptibility genes for monomelic amyotrophy. PMID: 22264561