Recombinant Human Uncharacterized Protein C8Orf4 (TCIM) Protein (GST)

Name: Recombinant Human Uncharacterized Protein C8Orf4 (TCIM) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08681P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Uncharacterized Protein C8Orf4 (TCIM) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9NR00
Target Symbol	TCIM
Synonyms	C8orf4; CH004_HUMAN; Chromosome 8 open reading frame 4; Human thyroid cancer 1; MGC22806; TC-1; TC1; Thyroid cancer protein 1; Uncharacterized protein C8orf4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH
Expression Range	1-106aa
Protein Length	Full Length
Mol. Weight	39.3kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1. Enhances the proliferation of follicular dendritic cells. Plays a role in the mitogen-activated MAPK2/3 signaling pathway, positively regulates G1-to-S-phase transition of the cell cycle. In endothelial cells, enhances key inflammatory mediators and inflammatory response through the modulation of NF-kappaB transcriptional regulatory activity. Involved in the regulation of heat shock response, seems to play a positive feedback with HSF1 to modulate heat-shock downstream gene expression. Plays a role in the regulation of hematopoiesis even if the mechanisms are unknown. In cancers such as thyroid or lung cancer, it has been described as promoter of cell proliferation, G1-to-S-phase transition and inhibitor of apoptosis. However, it negatively regulates self-renewal of liver cancer cells via suppresion of NOTCH2 signaling.
Subcellular Location	Cytoplasm. Nucleus, nucleolus. Nucleus speckle. Nucleus.
Database References	HGNC: 1357 OMIM: 607702 KEGG: hsa:56892 STRING: 9606.ENSP00000319914 UniGene: PMID: 29842886 Decreased capacity of fibrotic lung fibroblasts to up-regulate COX-2 expression and COX-2-derived PGE2 synthesis is due to an indirect epigenetic mechanism involving hypermethylation of the transcriptional regulator, c8orf4. PMID: 26744410 C8orf4 negatively regulates the self-renewal of liver CSCs via suppression of NOTCH2 signalling PMID: 25985737 the high expression of TC1 was common in oral tongue squamous cell carcinomas and correlated with the expression of b-catenin and cyclin D1 and the progression of oral tongue squamous cell carcinomas PMID: 25869879 TC-1 overexpression promotes cell proliferation in human non-small cell lung cancer that can be inhibited by PD173074. PMID: 24941347 TC-1 expression is associated with aggressive biologic behavior in lung cancer and might coordinate with the Wnt/beta-catenin pathway as a positive upstream regulator that induces these behaviors. PMID: 23880650 The higher expression of TC-1 in ovarian compared to colorectal adenocarcinomas suggests its potential use as a marker PMID: 23377761 The SNP rs10958605 in the C8orf4 gene had the smallest p value in analyses of the motor outcome. PMID: 22658654 A significant association was found between the copy-number deletions of C8orf4 and the risk of hematological malignancies. PMID: 20878554 Overexpression of TC-1 may be important in thyroid carcinogenesis. PMID: 15087392 data indicate that TC1 is a novel upstream regulator of the Wnt/beta-catenin pathway that enhances aggressive behavior of cancers PMID: 16424001 The TC1 coordinates the up-regulation of Wnt/beta-catenin target genes that are implicated in the aggressive biological behavior of cancers. PMID: 16740781 Gene induces transformed phenotype when overexpressed in a cancer breast cell line. PMID: 17178857 TC-1 over expression is transforming and may link with the FGFR pathway in a subset of breast cancer. PMID: 17520678 Our data suggest that TC1 is a novel heat shock response regulator. PMID: 17603013 intrinsically disordered TC-1 interacts with Cby via its transient helical structure PMID: 17905836 TC1 was involved in the mitogen-activated ERK1/2 signaling pathway and positively regulated G(1)- to S-phase transition of the cell cycle. PMID: 18959821

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.