Recombinant Human Uncharacterized Protein C11Orf73 (HIKESHI) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10129P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Uncharacterized Protein C11Orf73 (HIKESHI) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10129P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Uncharacterized Protein C11Orf73 (HIKESHI) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q53FT3 |
| Target Symbol | HIKESHI |
| Synonyms | C11orf73; Chromosome 11 open reading frame 73; CK073_HUMAN; FLJ43020; Hikeshi; HSPC138; HSPC179; L7RN6; Lethal Chr 7 Rinchik 6; OPI10; Protein Hikeshi; Uncharacterized protein C11orf73 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLLGFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT |
| Expression Range | 1-197aa |
| Protein Length | Full Length |
| Mol. Weight | 37.6kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus. |
| Subcellular Location | Cytoplasm. Cytoplasm, cytosol. Nucleus. |
| Protein Families | OPI10 family |
| Database References | HGNC: 26938 OMIM: 614908 KEGG: hsa:51501 STRING: 9606.ENSP00000278483 UniGene: PMID: 28731175 |
