Recombinant Human Ul16-Binding Protein 2 (ULBP2) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05876P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ul16-Binding Protein 2 (ULBP2) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05876P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Ul16-Binding Protein 2 (ULBP2) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml. |
Uniprotkb | Q9BZM5 |
Target Symbol | ULBP2 |
Synonyms | ALCAN alpha; ALCAN-alpha; N2DL 2; N2DL-2; N2DL2; N2DL2_HUMAN; NKG2D ligand 2; NKG2D ligand 2 precursor; NKG2DL2; RAET1H; Retinoic acid early transcript 1 H; Retinoic acid early transcript 1H; UL16 binding protein 2; UL16-binding protein 2; ULBP2 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Complete Sequence | GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS |
Expression Range | 26-217aa |
Protein Length | Partial |
Mol. Weight | 51.4 kDa |
Research Area | Immunology |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. Endoplasmic reticulum. Secreted. |
Protein Families | MHC class I family |
Database References | HGNC: 14894 OMIM: 605698 KEGG: hsa:80328 STRING: 9606.ENSP00000356320 UniGene: PMID: 27477692 |