Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04325P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-04325P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ubiquitin-Conjugating Enzyme E2 Variant 2 (UBE2V2) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q15819 |
| Target Symbol | UBE2V2 |
| Synonyms | 1 alpha 25 dihydroxyvitamin D3 inducible; DDVit 1; DDVIT1; EDAF-1; EDAF1; EDPF-1; EDPF1; Enterocyte differentiation associated factor EDAF 1; Enterocyte differentiation promoting factor; Enterocyte differentiation-associated factor 1; Enterocyte differentiation-promoting factor 1; Methyl methanesulfonate sensitive 2; MMS 2; MMS2; MMS2 homolog; UB2V2_HUMAN; UBE2V 2; UBE2V2; Ubiquitin conjugating enzyme E2 variant 2; Ubiquitin conjugating enzyme E2v2; Ubiquitin-conjugating enzyme E2 variant 2; UEV 2; UEV2; Vitamin D3 inducible protein; Vitamin D3-inducible protein |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
| Expression Range | 2-145aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 32.2kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. |
| Protein Families | Ubiquitin-conjugating enzyme family |
| Database References | HGNC: 12495 OMIM: 603001 KEGG: hsa:7336 STRING: 9606.ENSP00000428209 UniGene: PMID: 25910425 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
