Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L5 (UCHL5) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10242P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L5 (UCHL5) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-10242P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase Isozyme L5 (UCHL5) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9Y5K5 |
| Target Symbol | UCHL5 |
| Synonyms | UCH37; AD-019; CGI 70; INO80 complex subunit R; INO80R; Ubiquitin C terminal hydrolase L5; Ubiquitin C terminal hydrolase UCH37; Ubiquitin C-terminal hydrolase UCH37; Ubiquitin carboxyl terminal esterase L5; Ubiquitin carboxyl terminal hydrolase isozyme L5; Ubiquitin carboxyl terminal hydrolase L5; Ubiquitin carboxyl-terminal hydrolase isozyme L5; Ubiquitin thioesterase L5; Ubiquitin thiolesterase L5; UCH L5; UCH-L5; UCHL5; UCHL5_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK |
| Expression Range | 1-326aa |
| Protein Length | Full Length of Isoform 4 |
| Mol. Weight | 53.4kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1. |
| Subcellular Location | Cytoplasm. Nucleus. Note=Associates with the proteasome 19S subunit in the cytoplasm. Associates with the INO80 complex in the nucleus. |
| Protein Families | Peptidase C12 family |
| Database References | HGNC: 19678 OMIM: 610667 KEGG: hsa:51377 STRING: 9606.ENSP00000356425 UniGene: PMID: 28198400 |
