Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 6 (USP6) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-01022P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 6 (USP6) Protein (His-KSI)
Beta LifeScience
SKU/CAT #: BLC-01022P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase 6 (USP6) Protein (His-KSI) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P35125 |
| Target Symbol | USP6 |
| Synonyms | (Deubiquitinating enzyme 6)(Proto-oncogene TRE-2)(Ubiquitin thioesterase 6)(Ubiquitin-specific-processing protease 6) |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-KSI |
| Target Protein Sequence | KLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLS |
| Expression Range | 348-535aa |
| Protein Length | Partial |
| Mol. Weight | 36.0 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation. |
| Subcellular Location | Cell membrane. Cytoplasm. Endosome. Note=Localizes to the plasma membrane and to filamentous structures within the cell corresponding to ARF6 regulated tubular endosomes. Activation of RAC1 and CDC42 can direct the relocalization of USP6 to the plasma membrane in a manner that depends on the integrity of the actin cytoskeleton. |
| Protein Families | Peptidase C19 family |
| Database References | HGNC: 12629 OMIM: 604334 KEGG: hsa:9098 STRING: 9606.ENSP00000250066 UniGene: PMID: 29617048 |
