Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) Protein (His&Myc)

Name: Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-00065P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P18031
Target Symbol	PTPN1
Synonyms	TP1B; Non receptor tyrosine phosphatase 1; Protein phosphotyrosylphosphatase 1B; Protein tyrosine phosphatase 1B; Protein tyrosine phosphatase non receptor type 1; Protein tyrosine phosphatase placental; Protein-tyrosine phosphatase 1B; PTN1_HUMAN; PTP 1B; PTP-1B; PTPN 1; PTPN1; Tyrosine protein phosphatase non receptor type 1; Tyrosine-protein phosphatase non-receptor type 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN
Expression Range	1-321aa
Protein Length	Partial
Mol. Weight	44.8 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Tyrosine-protein phosphatase which acts as a regulator of endoplasmic reticulum unfolded protein response. Mediates dephosphorylation of EIF2AK3/PERK; inactivating the protein kinase activity of EIF2AK3/PERK. May play an important role in CKII- and p60c-src-induced signal transduction cascades. May regulate the EFNA5-EPHA3 signaling pathway which modulates cell reorganization and cell-cell repulsion. May also regulate the hepatocyte growth factor receptor signaling pathway through dephosphorylation of MET.
Subcellular Location	Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Note=Interacts with EPHA3 at the cell membrane.
Protein Families	Protein-tyrosine phosphatase family, Non-receptor class 1 subfamily
Database References	HGNC: 9642 OMIM: 176885 KEGG: hsa:5770 STRING: 9606.ENSP00000360683 UniGene: PMID: 29604334 High-Resolution PTP1B Inhibition Profiling Combined with HPLC-HRMS-SPE-NMR for Identification of PTP1B Inhibitors from Miconia albicans. PMID: 30018269 The expression of PTP1B in skeletal muscle was increased after caloric restriction and prolonged exercise. PMID: 28729389 preliminary data show that heterozygous or homozygous deletion of PTPN1 increases the severity of MPN in Jak2V617F-knock-in mice. Future studies will determine whether loss of PTPN1 cooperates with the JAK2V617F mutation in the pathogenesis of MPN PMID: 28111468 we demonstrated a novel oncogenic mechanism of PTP1B on affecting PITX1/p120RasGAP in colorectal carcinoma(CRC). Regorafenib inhibited CRC survival through reserving PTP1B-dependant PITX1/p120RasGAP downregulation. PTP1B may be a potential biomarker predicting regorafenib effectiveness, and a potential solution for CRC PMID: 27752061 this study highlights an important role for Nck1 in fine-tuning IRE1alpha expression and signaling that regulate PTP1B expression and subsequent activation of the PI3K-Akt pathway in HepG2 cells. PMID: 28455143 In conclusion, HDAC6 might enhance aggressive melanoma cells progression via interacting with PTPN1, which was independent of its histone modifying activity. PMID: 29278704 PTP1B is widely expressed in the human breast gland with highest expression in myoepithelial cells and fibroblasts. Inhibition of PTP1B in D492 and HMLE affects cell-cell adhesion and induces anoikis-like effects. PMID: 28492548 The results of the present study highlight the expression quantitative trait loci enrichment and pleiotropy in psoriasis and schizophrenia, and also suggest a possible key role of the PTPN1 gene in the etiology of psoriasis PMID: 27976820 The structural fragments which are important for PTP1B inhibition were identified by naive Bayesian method and can be further exploited to design new molecules around the identified scaffolds. The descriptive and predictive modeling strategy applied in this study is capable of identifying PTP1B inhibitors from the large compound libraries PMID: 28006676 The gained results are observed not only the unbinding mechanism of IRK-PTP1B complexes came from pulling force profile, number of hydrogen bonds, and interaction energy between IRK and PTP1Bs but also described PTP1B's point mutations could variably change its binding affinity towards IRK. PMID: 28707052 these results suggest that inhibition of PTP1B activity is a promising new target in the treatment of colorectal cancer and the prevention of metastasis PMID: 26942883 the molecular mechanisms by which PTP1B and TC-PTP loss co-operates with other genetic aberrations will need to be elucidated to design more effective therapeutic strategies. PMID: 26817397 The findings show that reduced PTP1B responses contribute to disease symptoms in part by enhancing S100A9 expression during viral-associated chronic obstructive pulmonary disease exacerbations. PMID: 26813343 Both the rs2904268 C>G CG and GG genotype frequencies were markedly higher in the ESCC group relative to the control group (both p < 0.05). However, the genotype frequencies of rs2230605A>G and rs16995309 C>T were similar between the ESCC and control groups These results indicated that the PTPN1 gene polymorphism rs2904268 is associated with susceptibility to Esophageal Squamous Cell Carcinoma in Inner Mongolia. PMID: 28287835 Data suggest TrxR1 and NADPH directly protect PTP1B from inactivation by oxidation; this protection is independent of TRX1 and PRX2; this protection is blocked by auranofin (an inhibitor of TrxR1 and requires an intact selenocysteine residue in TrxR1. (TrxR1 = thioredoxin reductase 1; PTP1B = protein tyrosine phosphatase, non-receptor type 1; TRX1 = thioredoxin-1; PRX2 = paired related homeobox 2 protein) PMID: 28684416 Regulation of platelet-activating factor-mediated PTP1B activation by a Janus kinase 2/ calpain pathway has been reported. PMID: 28686728 PTP1B was overexpressed in over 70% of breast cancer tissues, correlating with patients with estrogen receptor (ER)-negative, progesterone receptor (PR)-negative, and human epidermal growth factor receptor 2 (HER2)-positive tumors. The data also showed that both tumor size and lymph node metastasis were significantly higher in patients with a higher level of PTP1B. PMID: 28378571 PTP1B uses conformational and dynamic allostery to regulate its activity. Both conformational rigidity and dynamics are essential for controlling protein activity. PMID: 28212750 PTP1BDelta6 is a positive regulator of JAK/STAT signaling in classical Hodgkin lymphoma cells.( PMID: 28082443 In PTP1B and VHR, two new allosteric clusters were identified in each enzyme. PMID: 28625849 The PTP1BDeltaE6 mutant expressed in colon and thyroid tumors and another PTP1BDeltaE5 mutant expressed in colon tumor were studied in more detail. PMID: 27855221 PTP1B/RNF213/alpha-KGDD pathway is critical for survival of HER2(+) breast cancer, and possibly other malignancies, in the hypoxic tumour microenvironment PMID: 27323329 data for the first time demonstrate a calpain/PTP1B/VEGFR2 negative feedback loop in the regulation of VEGF-induced angiogenesis. Modulation of local PTP1B and/or calpain activities may prove beneficial in the treatment of impaired wound healing in diabetes. PMID: 27872190 Data show that cichoric acid (CHA) is a competitive inhibitor that binds in the active site of protein tyrosine phosphatase 1B (PTP1B), and chlorogenic acid (CGA), while a noncompetitive inhibitor, binds in the second aryl phosphate binding site, rather than the predicted benzfuran binding pocket. PMID: 27959494 stimulation of the DOCK180 pathway represents an alternative mechanism of PTP1B inhibitor-stimulated endothelial cell motility, which does not require concomitant VEGFR2 activation as a prerequisite. PMID: 27052191 Overexpression of PTP1B is associated with breast neoplasms. PMID: 27465552 The analysis revealed three candidate genes GSK3B, PTPN1, STX4 that are differentially expressed in study subjects. GSK3B was highly significant in Ps-T2D (P=0.00018, FR=-26.6), followed by Ps (P=0.0028, FR=-14.5) and T2D groups (P=0.032, FR=-5.9). PTPN1 showed significant association only with PS-T2D (P=0.00027, FR=-8.5). STX4 showed significant association with both Ps (P=0.0002, FR=-20) and Ps-T2D (P=0.0016, FR=-11.2). PMID: 27530212 PTP1B directly regulates STAT5 phosphorylation and its activation via the cAMP/PKA pathway downstream of the 5-HT7 receptor is involved in the suppression of beta-casein expression in MCF-12A cells PMID: 27016479 On EGF stimulation, complexes containing Mena and PTP1B are recruited to the EGFR, causing receptor dephosphorylation and leading to decreased motility responses. PMID: 26337385 PTP1B dephosphorylates PITX1 to weaken its protein stability and the transcriptional activity for p120RasGAP gene expression PMID: 26840794 our data indicate that by targeting PTP1B, miR-744 plays a feed-forward role in regulating type I IFN signaling pathway. PMID: 26259828 O-GlcNAcylation of PTP1B can influence insulin signal transduction by modulating its own phosphatase activity, which participates in the process of hepatic insulin resistance. PMID: 26402673 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcomes imatinib-resistance of K562 cells. PMID: 26721204 the multiple roles of PTP1B in liver diseases will be presented, with respect to liver regeneration, drug-induced liver disease, non-alcoholic fatty liver disease (NAFLD) and hepatocellular carcinoma--{REVIEW} PMID: 26299811 PTP1B amplification predicts poor survival of gastric cancer patients. PMID: 25590580 the hydrogen bond and energy decomposition analyses indicate that apart from residue 181, point mutations have influence on the interactions of substrate with several residues in the active site of PTP1B PMID: 24865376 Nck1 depletion induces activation of the PI3K/Akt pathway by attenuating PTP1B protein expression PMID: 25398386 Findings suggest that the second sphere residues of PTP1B active site may play important roles in PTP-mediated function in both normal and diseased states. PMID: 25450460 PTP1B sub-cellular location and tight control of enzymatic activity by diverse post-translational modifications illustrate the dynamic regulation of this enzyme and its ability to modulate numerous signaling pathways, likely in a cell/tissue- and stimulus-dependent manner, with high specificity and precision. [Review] PMID: 25263014 FGFR3 regulation by PTPN1 and PTPN2 depend on FGFR3 localization and A-loop sequence. PMID: 25311528 Data shows a relationship between the dephosphorylation rate of different factors in signaling pathways related to cell proliferation and PTP1B activation. PMID: 25668475 Fumosorinone increased glucose uptake and improved insulin resistance by down-regulating the expression of PTP1B and activating the insulin signaling pathway, suggesting that it may possess antidiabetic properties. PMID: 25796170 M3R preserves the endothelial barrier function through a mechanism potentially maintaining PTP1B activity, keeping the adherens junction proteins (AJPs) dephosphorylation. PMID: 24393526 Data indicate that protein tyrosine phosphatase 1B (PTP1B) association with calnexin is ubiquitin conjugating enzyme 9 (UBC9)-dependent. PMID: 25586181 PTP1B can promote non-small cell lung cancer proliferation and metastasis by activating src and subsequently ERK1/2. PMID: 25617799 protein tyrosine phosphatase 1B is regulated with a conformational rearrangement in helix alpha7, disrupting the triangular interaction among helix alpha7, helix alpha3, and loop11 PMID: 24831294 PTP1B is a novel physiological regulator of TrkB and enhanced BDNF/TrkB signaling may contribute to the beneficial metabolic effects of PTP1B deficiency PMID: 25288805 Nox4-mediated redox regulation of PTP1B serves as a modulator, in part through coronin-1C, of the growth and migration of glioblastoma cells. PMID: 24239742 PTP1B has a role in the modulation of insulin signaling by acetaminophen in hepatocytes PMID: 25204659

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) Protein (His&Myc)

Recombinant Human Tyrosine-Protein Phosphatase Non-Receptor Type 1 (PTPN1) Protein (His&Myc)

Product Overview

Target Details

FAQs