Recombinant Human Tyrosine-Protein Kinase Jak2 (JAK2) Protein (His)

Name: Recombinant Human Tyrosine-Protein Kinase Jak2 (JAK2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04416P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) JAK2.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tyrosine-Protein Kinase Jak2 (JAK2) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O60674
Target Symbol	JAK2
Synonyms	JAK 2; JAK-2; JAK2; JAK2_HUMAN; Janus Activating Kinase 2; Janus kinase 2 (a protein tyrosine kinase); Janus kinase 2; JTK 10; JTK10; kinase Jak2; OTTHUMP00000043260; THCYT3; Tyrosine protein kinase JAK2; Tyrosine-protein kinase JAK2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	KPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Expression Range	752-1132aa
Protein Length	Partial
Mol. Weight	48.6kDa
Research Area	Immunology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Non-receptor tyrosine kinase involved in various processes such as cell growth, development, differentiation or histone modifications. Mediates essential signaling events in both innate and adaptive immunity. In the cytoplasm, plays a pivotal role in signal transduction via its association with type I receptors such as growth hormone (GHR), prolactin (PRLR), leptin (LEPR), erythropoietin (EPOR), thrombopoietin (THPO); or type II receptors including IFN-alpha, IFN-beta, IFN-gamma and multiple interleukins. Following ligand-binding to cell surface receptors, phosphorylates specific tyrosine residues on the cytoplasmic tails of the receptor, creating docking sites for STATs proteins. Subsequently, phosphorylates the STATs proteins once they are recruited to the receptor. Phosphorylated STATs then form homodimer or heterodimers and translocate to the nucleus to activate gene transcription. For example, cell stimulation with erythropoietin (EPO) during erythropoiesis leads to JAK2 autophosphorylation, activation, and its association with erythropoietin receptor (EPOR) that becomes phosphorylated in its cytoplasmic domain. Then, STAT5 (STAT5A or STAT5B) is recruited, phosphorylated and activated by JAK2. Once activated, dimerized STAT5 translocates into the nucleus and promotes the transcription of several essential genes involved in the modulation of erythropoiesis. Part of a signaling cascade that is activated by increased cellular retinol and that leads to the activation of STAT5 (STAT5A or STAT5B). In addition, JAK2 mediates angiotensin-2-induced ARHGEF1 phosphorylation. Plays a role in cell cycle by phosphorylating CDKN1B. Cooperates with TEC through reciprocal phosphorylation to mediate cytokine-driven activation of FOS transcription. In the nucleus, plays a key role in chromatin by specifically mediating phosphorylation of 'Tyr-41' of histone H3 (H3Y41ph), a specific tag that promotes exclusion of CBX5 (HP1 alpha) from chromatin.
Subcellular Location	Endomembrane system; Peripheral membrane protein. Cytoplasm. Nucleus.
Protein Families	Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Database References	HGNC: 6192 OMIM: 147796 KEGG: hsa:3717 STRING: 9606.ENSP00000371067 UniGene: PMID: 28550306 Patients with CALR mutation had significantly higher concentration of PDGF-BB and lower concentration of SDF-1alpha than patients with JAK2V617F mutation. High concentration of PDGF-BB and low concentration of SDF-1alpha in patients with CALR(+) ET may indicate a contribution of these chemokines in disturbed Ca2+ metabolism in platelets. PMID: 29390868 Here, we present two crystal structures of the human JAK2 FERM and SH2 domains bound to Leptin receptor (LEPR) and Erythropoietin receptor (EPOR), which identify a novel dimeric conformation for JAK2. PMID: 30044226 pathogenesis mechanism of JAK2 F556V mutation in the MPNs PMID: 29842959 Mir-204 attenuates angiogenesis in lung adenocarcinoma via JAK2-STAT3 pathway. PMID: 29281186 FEZF1-AS1 acts as an oncogenic lncRNA in human hepatocellular carcinoma by promoting JAK2/STAT3 signaling-mediated epithelial mesenchymal transformation. PMID: 29957463 Case Reports/Review: JAK2 mutation-associated cerebral arterial infarction and cerebral and systemic venous thromboembolism. PMID: 30056970 HSP27 is a partner of JAK2-STAT5 and a potential therapeutic target in myelofibrosis. PMID: 29650953 Our study suggests that JAK2V617F mutation may increase the risk of thrombosis in chronic myeloproliferative neoplasms. PMID: 30004057 Progression to polythythemia vera from familial thrombocytosis with germline JAK2 R867Q mutation. PMID: 29368262 JAK2 and STAT3 are activated in Idiopathic pulmonary fibrosis PMID: 29409529 The prevalence of CALR mutation in JAK2V617F-negative essential thrombocythemia in this study is 35.7%. HRM is an effective method of detecting CALR mutation and is a more advantageous method of screening for CALR mutation. PMID: 29521158 Comprehensive genomic characterization identified distinct genetic subgroups and provided a classification of myeloproliferative neoplasms on the basis of causal biologic mechanisms. Mutations in JAK2, CALR, or MPL being the sole abnormality in 45% of the patients. PMID: 30304655 Findings outlined in the current study demonstrated that the inhibition of P16 decreased the growth and metastasis potential of BC cells by inhibiting IL-6/JAK2/STAT3 signaling. PMID: 29388151 MPL-mutated and CALR-mutated essential thrombocythaemia share clinical and histological characteristics, with both genotypes showing higher platelet counts and a marked megakaryocytic proliferation in comparison with JAK2V617F-mutated ET. PMID: 29934356 results herein provide clues to understand the mechanism JAK2 V625F mutation caused myeloproliferative neoplasms and give information for the development of JAK2 mutation specific inhibitors. PMID: 29782975 Concomitant presence of JAK2V617F mutation and BCRABL translocation in two patients: A new entity or a variant of myeloproliferative neoplasms. PMID: 29845291 The JAK2 V617F mutation and thrombocytopenia. PMID: 27614229 PBX1 plays an oncogenic role in clear cell renal carcinoma via JAK2/STAT3 pathway PMID: 29678569 Our study shows that JAK2V617F leads to abnormal expression of numerous proteins at the membrane of circulating PV red blood cells, with overexpression of CALR and persistence of CANX PMID: 28385780 In 94.9% of PV, 85.5% ET and 85.2% PMF, authors found mutations in JAK2, MPL or CALR. 74.9% carried JAK2V617F, 12.3% CALR mutations, 2.1% MPL mutations and 10.7% were triple negative. PMID: 28990497 tyrphostin B42 induced the apoptosis of pancreatic cancer cells (PCCs) by regulating the expression of mitochondrialrelated genes. Therefore, these findings demonstrated that tyrphostin B42 attenuated trichostatin A resistance in PCCs by antagonizing the IL6/JAK2/STAT3 signaling PMID: 29393444 MiR-375 inhibits fetal ASM cell proliferation and migration by targeting JAK2/STAT3 signaling. PMID: 29245068 data show that HIT is more frequent, during heparin treatment, in patients with ET carrying V617F mutation, as compared with patients without mutations PMID: 29022213 Overexpression of ALK4 suppressed glioma cell proliferation, migration and invasion through the inactivation of JAK/STAT3 signaling pathway. PMID: 29278854 We describe a subset of non-small-cell lung cancer patients who had JAK2 amplifications resulting in high expression of PD-L1 PMID: 28795418 High JAK2 expression is associated with hepatocellular carcinoma. PMID: 28677802 JAK2 haplotype 46/1 and JAK2 V617F allele burden in MPN PMID: 29134760 Low JAK2 expression is associated with gastric cancer. PMID: 28656307 The authors discovered tyrosine 78 of Atoh1 is phosphorylated by a Jak2-mediated pathway only in tumor-initiating cells and in human Sonic Hedgehog-type medulloblastoma. PMID: 29168692 conclude that the activating JAK2 V617F mutation does not play a decisive role in the pathogenesis of progressive CKD PMID: 27889755 Our findings revealed that B7-H3 affect ovarian cancer progression through the Jak2/Stat3 pathway, indicating that B7-H3 has the potential to be a useful prognostic marker. PMID: 28765941 In 136 patients with myelofibrosis and a median age of 58 years who underwent allogeneic stem cell transplantation (AHSCT) for molecular residual disease, the percentage of molecular clearance on day 100 was higher in CALR-mutated patients (92%) in comparison with MPL- (75%) and JAKV617F-mutated patients (67%). PMID: 28714945 Mutational subtypes of JAK2 correlate with different clinical features in Japanese patients with myeloproliferative neoplasms. PMID: 29464483 identification of activating somatic mutations in JAK2 and germline mutations in JAK3 with clinical implications PMID: 29082853 Screening for the JAK2 V617F mutation in cerebral venous thrombosis patients seems to be useful because of its relatively high prevalence and the risk of thrombosis recurrence. PMID: 28609766 Ascochlorin significantly decreased phosphorylation of JAK2/STAT3, cancer cell migration and nuclear translocation of STAT3. PMID: 28569433 TLR7, TLR9, and JAK2 genes are potential biomarkers for systemic sclerosis. High TLR7 expression positively correlated with the late form of disease. Decreased levels of TLR9 and JAK2 mRNA were found in the patient's cohort in comparison to non-SSc individuals. PMID: 29147913 This study demonstrated that the JAK2V617F mutation was detectable in Patients with Stroke. PMID: 28625126 Curcumin attenuated neuropathic pain and down-regulated the production of spinal mature IL-1beta by inhibiting the aggregation of NALP1 inflammasome and the activation of the JAK2-STAT3 cascade in astrocytes. PMID: 27381056 High level of phosphorylated JAK2, and STAT3 are associated with systemic lupus erythematosus. PMID: 28177455 this study shows that Nrf2 activation induces lipocyte phenotype in hepatic stellate cells via enhancing SOCS3-dependent feedback inhibition on JAK2/STAT3 cascade PMID: 28601022 bladder cancer cell may inhibit maturation and function of dendritic cells involving of Jak2/STAT3 pathway, and there may be different mechanisms by which adriamycin-resistant BCC restrains DC function in antitumor immune response PMID: 27556503 Multivariate analysis adjusted for age, sex, follow-up period and hematological parameters confirmed that increased activated B cells were universally present in JAK2-mutated, CALR-mutated and triple-negative ET patients when compared to healthy adults. PMID: 28415571 In multivariable analysis, younger age, platelet count, hemoglobin level and JAK2 V617F mutation independently predicted the development of acquired von Willebrand syndrome (AVWS) among essential thrombocythemia (ET)patients; whereas only platelet count predicted its development among polycythemia vera (PV) patients. Among ET patients, JAK2 V617F was a main driver for the development of AVWS. PMID: 27919526 CXCR4 induced VEGF production and JAK2/STAT3 activation and enhanced STAT3 binding to VEGF promoter in gastric cancer cells. PMID: 28544312 these results reveal proteome alterations in MPN granulocytes depending on the phenotype and genotype of patients, highlighting new oncogenic mechanisms associated with JAK2 mutations and overexpression of calreticulin PMID: 28314843 JAK2 mutation is associated with Essential thrombocythemia. PMID: 28205126 Considering JAK2(V617F) -positive disease, a higher (>50%) JAK2(V617F) burden and histological classification are independent prognostic risk factors for disease progression. PMID: 28509339 Taken together, we found that silibinin inhibits the Jak2/STAT3/MMP2 signaling pathway, and inhibits the proliferation, migration, and invasion of triple-negative breast cancer cells. PMID: 28440514

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.