Recombinant Human Type-1 Angiotensin Ii Receptor (AGTR1) Protein (His)

Name: Recombinant Human Type-1 Angiotensin Ii Receptor (AGTR1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10056P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Type-1 Angiotensin Ii Receptor (AGTR1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P30556
Target Symbol	AGTR1
Synonyms	AG2S; Agtr 1; Agtr1; AGTR1_HUMAN; Agtr1a; AGTR1B; Ang II; Angiotensin II receptor type 1; Angiotensin II type-1 receptor; Angiotensin receptor 1; Angiotensin receptor 1B; AT 1B; AT 1r; AT1; At1a; AT1AR; AT1B; AT1BR; AT1R; AT2R1; AT2R1A; AT2R1B; HAT1R; Type 1 angiotensin II receptor; Type 1B angiotensin II receptor; Type-1 angiotensin II receptor
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	LNPLFYGFLGKKFKRYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNVSSSTKKPAPCFEVE
Expression Range	297-359aa
Protein Length	Partial
Mol. Weight	9.2kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, it is able to recognize and internalize the complex formed by secreted ACE2 and SARS-CoV-2 spike protein through DNM2/dynamin 2-dependent endocytosis.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	G-protein coupled receptor 1 family
Database References	HGNC: 336 OMIM: 106165 KEGG: hsa:185 STRING: 9606.ENSP00000273430 UniGene: Hs.477887
Associated Diseases	Renal tubular dysgenesis (RTD)
Tissue Specificity	Liver, lung, adrenal and adrenocortical adenomas.

Gene Functions References

Intracrine action of angiotensin II in mesangial cells: subcellular distribution of angiotensin II receptor subtypes AT1 and AT2. PMID: 29455433
Meta-analysis suggests that AGTR1 A1166C polymorphism may increase the susceptibility to diabetic nephropathy. PMID: 30313019
Results may indicate that the choice of diet can undermine the potential genetic risk of the AT1R 1166A>C polymorphism for MetS, and persons who are variant carriers may spontaneously choose the Mediterranean diet. PMID: 30205174
The research reveals that among patients with essential hypertension treated with hypotensive drugs there are certain relationships between the rs5182 and rs5186 polymorphisms of the AGTR1 gene, as well as between the rs1799998 polymorphism of the CYP11B2 gene and the volume of the carotid bodies. PMID: 29627490
The protective effects of short-term hypoxia (STH) are associated with the upregulation of MasR to inhibit AT1 R signaling. STH could be a potential therapeutic strategy for cardiac diseases in hypertensive patients. PMID: 29052864
A high level of ART1 antibodies was a risk factor for allograft function in kidney transplant recipients. PMID: 29507275
we found an interaction between ACE2 and AGTR1 in structuralatrial fibrillation patients in a Chinese Han population PMID: 29441892
AGTR1 DNA hypomethylation is a risk factor for the development of hypertension. Furthermore, there is a correlation between smoking, diet, and AGTR1 DNA methylation levels. PMID: 28376480
Chinese Han persons with C allele of rs9817428 in PPARG gene were related to the increased risk of hypertension. PMID: 29266977
Association of AGTR1 single nucleotide polymorphism rs275645 and pre-eclampsia in Chinese population. PMID: 27910864
although the present study did not find any association between AGTR1 A1166C polymorphism and the risk of systemic lupus erythematosus, the presence of this polymorphism was associated with higher levels of malondialdehyde and higher concentration of neopterin PMID: 28530466
We conclude that the crosstalk between angiotensin AT1 receptor and insulin receptor signaling shows a high degree of specificity, and involves Galphaq protein, and activation of distinct kinases. Thus, the BRET(2) technique can be used as a platform for studying molecular mechanisms of crosstalk between insulin receptor and 7TM receptors. PMID: 28854843
The AGTR1-mediated cell apoptosis was suppressed by overexpressing miR-1248 and inhibited protein translation of AGTR1 by miR-1248, through binding to the 3'-UTR of the AGTR1 mRNA. PMID: 29482191
The effects ofgenetic polymorphisms and diet on the risk of metabolic disorders predisposing to cardiovascular diseases among Malay, Chinese, and South Asian persons are reported. PMID: 28792482
AGTR1 gene, related to renin-angiotensin system, might play momentous roles in the initiation and development of consecutive Trauma-Induced Sepsis. PMID: 29642183
The genotypes of REN, AT1R and AT2R were not associated with the development of preeclampsia in South African Black women. PMID: 28641212
AC-CC genotype of AT1R and noise were the risky factors of EH. These factors also interacted with each other. PMID: 28157766
the A1166C polymorphism in the AGTR1 gene may not be a risk factor for breast cancer (Meta-Analysis) PMID: 26634463
High levels of AT1R is associated with angiogenesis in bladder cancer. PMID: 28599664
High angiotensin II type 1 receptor antibodies are associated with graft rejection in renal transplantation. PMID: 26546592
No statistically significant data on the correlation between the AGTR1 A/C polymorphism and the development of Atrial Fibrillation were obtained in any patient subgroup of a Siberian population. PMID: 29039830
Letter/Case Report: refractory vascular rejection in a hand transplant recipient in the presence of AGTR1 antibodies. PMID: 28767535
These findings suggest that AT1R overexpression is an independent adverse prognosticator for patients with esophageal squamous cell carcinoma PMID: 27564102
As previously found for rs1799752 in ACE, rs5186 in AGTR1 was associated with dementia at baseline. These associations became substantially weaker, or disappeared, when dementia onset to 2012 was included. PMID: 27639288
Study identified the first significant associations between SNPs rs275651, rs275652 and rs4524238 in AGTR1 gene and high-altitude pulmonary edema susceptibility. PMID: 27732943
There was no association for rs5186 with LVH under any of models. PMID: 28513230
Homocysteine displaces angiotensin II and regulates the conformation of the AT1 receptor. PMID: 29296021
no statistical association with kidney graft failure was found for anti-AT1R antibodies, indicating that these tests may not be the best predictors of graft outcome in living donor renal transplantation. PMID: 28372986
Inhibition of CaV1.2 upregulates AT1R signaling in response to angiotensin II. PMID: 28514967
Single nucleotide polymorphisms of AGTR1 gene are associated with Hypertension. PMID: 27045027
The presence of AGTR1 autoantibodies is an independent predictor for aortic stiffness progression in normotensive subjects. PMID: 29097625
The DEGs, such as AGTR1, CYP3A4 and CYP4A11 may play critical roles in the development of HTN likely via the regulation by hsa-miR-26b-5p and taking part in some pathways. PMID: 27756246
Low shear stress induces the generation of endothelial reactive oxygen species via AT1R/eNOS/NO signaling pathway. PMID: 28518223
Low AGTR1 expression is associated with chemoresistance of osteosarcoma. PMID: 28073349
No relationship was found between the studied polymorphisms (14094 ACE gene, rs1800469 gene TGFbeta1, GNB3 gene rs5443, rs5186 AGTR1 gene) and the occurrence of primary vesicoureteral reflux. PMID: 27988909
Angiotensin II type 1 receptors promote ADAM17-mediated ACE2 shedding in the brain of hypertensive patients. PMID: 28512108
Data suggest that allosteric communication between heterodimeric AT1R and PTGFR is mediated through GNAQ and may also involve proximal phospholipase C but not distal protein kinase C signaling partners; PTGFR activation has negligible effects on AT1R-based conformational biosensors. (AT1R = angiotensin II receptor, type 1; PTGFR = prostaglandin F2alpha receptor; GNAQ = GTP-binding protein G[q] subunit alpha) PMID: 28584054
our results show the pivotal mechanisms of AT1R-induced harmful phenotype of Plasmodium-specific CD8(+) T cells during blood-stage malaria. PMID: 28261571
Ouabain stimulates NKA in renal proximal tubule cells through an angiotensin/AT1R-dependent mechanism and that this pathway contributes to cardiac glycoside associated hypertension. PMID: 27496272
Mutations within transmembrane domains IV, V, VI, and VII had no effect on angiotensin-mediated beta-arrestin1 recruitment; however, they exhibited differential effects on the assembly of AT1R into oligomeric complexes. PMID: 28096461
Our findings provide evidence that induction of APP shedding via Ang II/AT1 receptor stimulation is effected by G protein activation with Gbg subunits playing important roles. PMID: 28102934
highly and selectively expressed in colonic L cells PMID: 27447725
AT1R-Ab and anti-endothelial cell antibodies may identify patients at higher risk for antibody mediated injury, particularly in the presence of HLA-donor specific antibodies. PMID: 27222934
Structure and Function of Cross-class Complexes of G Protein-coupled Secretin and Angiotensin 1a Receptors. PMID: 27330080
studied the clinical significance of the AT1RA1166C receptor polymorphism and its relationship with serum concentration of lipids, oxidant/antioxidant systems and vascular adhesion protein-1(VAP-1) in 100 psoriatic patients and 100 gender- and age-matched unrelated healthy controls from west population of Iran PMID: 26395033
angiotensin II Type 1 receptor genotype may influence the clinical expression of vasculopathy in systemic sclerosis patients. PMID: 27488275
Single nucleotide polymorphisms (SNP) in angiotensin II receptor, type 1 (AGTR1), transcription factor AP-2 beta (TFAP2B), and tumor necrosis factor receptor-associated factor 1 (TRAF1) have been reported to be associated with the incidence of PDA in preterm infants. PMID: 26615960
AGTR1 rs3772622 gene polymorphism was not associated with the risk of developing non-alcoholic fatty liver disease (NAFLD), but could increase the risk of NAFLD patients suffering from coronary artery disease in the Chinese Han population. PMID: 27342049
Results demonstrated that rs1492099, a SNP of AGTR1 gene, could be a potential genetic risk factor of arterio-venous fistula malfunction in male hemodialysis patients. PMID: 27240348
Median total Angiotensin II type 1 receptor IgG concentration was significantly higher in the stable pediatric kidney transplant group as compared to the adult transplant group. For both groups, the transplant group showed higher levels than the control group. PMID: 27251358

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.