Recombinant Human TWEAK Protein (Animal Free)

Beta LifeScience SKU/CAT #: BLA-9323P
Recombinant Human TWEAK Protein (Animal Free)

Recombinant Human TWEAK Protein (Animal Free)

Beta LifeScience SKU/CAT #: BLA-9323P
Catalog No.: BLA-9323P

Product Overview

Host Species Human
Accession O43508
Synonym APO 3 ligand APO 3L APO3 ligand APO3/DR3 ligand APO3L DR3LG MGC129581 MGC20669 secreted form TNF-related weak inducer of apoptosis TNF12_HUMAN TNFSF 12 Tnfsf12 TNFSF12 protein Tumor necrosis factor (ligand) superfamily member 12 Tumor necrosis factor ligand superfamily member 12 Tumor necrosis factor superfamily member 12 TWEAK UNQ181/PRO207
Description Recombinant Human TWEAK Protein (Animal Free) was expressed in E.coli. It is a Protein fragment
Source E.coli
AA Sequence MKGRKTRARR AIAAHYEVHP RPGQDGAQAG VDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAV YLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLR IRTLPWAHLKAAPFLTYFGLFQVH
Molecular Weight 17 kDa
Purity >98% SDS-PAGE.assessed also by HPLC
Endotoxin < 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity Assay #1: The ED50 as determined by the dose-dependent stimulation of IL-8 production by human PBMC is less than 10 ng/ml. Assay #2: TWEAK weakly induces the death of HT29 cells when cultured in the presence of IFN-. The ED50 for this effect is between 30-45 ng/ml.
Formulation Lyophilised
Stability The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution See related COA
Unit Definition For Research Use Only
Storage Buffer Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Recently viewed