Recombinant Human TWEAK Protein (Animal Free)

Name: Recombinant Human TWEAK Protein (Animal Free)
Brand: Beta LifeScience
SKU: BLA-9323P
Availability: InStock

Collections: Cytokines and growth factors, Recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Host Species	Human
Accession	O43508
Synonym	APO 3 ligand APO 3L APO3 ligand APO3/DR3 ligand APO3L DR3LG MGC129581 MGC20669 secreted form TNF-related weak inducer of apoptosis TNF12_HUMAN TNFSF 12 Tnfsf12 TNFSF12 protein Tumor necrosis factor (ligand) superfamily member 12 Tumor necrosis factor ligand superfamily member 12 Tumor necrosis factor superfamily member 12 TWEAK UNQ181/PRO207
Description	Recombinant Human TWEAK Protein (Animal Free) was expressed in E.coli. It is a Protein fragment
Source	E.coli
AA Sequence	MKGRKTRARR AIAAHYEVHP RPGQDGAQAG VDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAV YLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLR IRTLPWAHLKAAPFLTYFGLFQVH
Molecular Weight	17 kDa
Purity	>98% SDS-PAGE.assessed also by HPLC
Endotoxin	< 1.0 EU per μg of the protein as determined by the LAL method
Bioactivity	Assay #1: The ED50 as determined by the dose-dependent stimulation of IL-8 production by human PBMC is less than 10 ng/ml. Assay #2: TWEAK weakly induces the death of HT29 cells when cultured in the presence of IFN-. The ED50 for this effect is between 30-45 ng/ml.
Formulation	Lyophilised
Stability	The recombinant protein samples are stable for up to 12 months at -80°C
Reconstitution	See related COA
Unit Definition	For Research Use Only
Storage Buffer	Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

Target Details

Target Function	Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein.
Protein Families	Tumor necrosis factor family
Database References	HGNC: 11927 OMIM: 602695 KEGG: hsa:407977 UniGene: Hs.54673
Tissue Specificity	Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Als

Gene Functions References

Observational study of gene-disease association. (HuGE Navigator) PMID: 19913121
Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20628086

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.