Recombinant Human Tumor Susceptibility Gene 101 Protein (TSG101) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02136P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Tumor Susceptibility Gene 101 Protein (TSG101) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02136P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Susceptibility Gene 101 Protein (TSG101) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q99816 |
| Target Symbol | TSG101 |
| Synonyms | ESCRT I complex subunit TSG101; ESCRT-I complex subunit TSG101; TS101_HUMAN; TSG 10; TSG 101; TSG10; Tsg101; Tumor susceptibility 101; Tumor susceptibility gene 10; Tumor susceptibility gene 101; Tumor susceptibility gene 101 protein; Tumor susceptibility protein; Tumor susceptibility protein isoform 3; VPS 23; VPS23 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP |
| Expression Range | 1-145aa |
| Protein Length | Partial |
| Mol. Weight | 36.6 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan. It may also play a role in the extracellular release of microvesicles that differ from the exosomes. |
| Subcellular Location | Cytoplasm. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Late endosome membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody, Midbody ring. Nucleus. |
| Protein Families | Ubiquitin-conjugating enzyme family, UEV subfamily |
| Database References | HGNC: 15971 OMIM: 601387 KEGG: hsa:7251 STRING: 9606.ENSP00000251968 UniGene: PMID: 30343281 |
