Recombinant Human Tumor Suppressor Candidate 2 (TUSC2) Protein (GST)

Name: Recombinant Human Tumor Suppressor Candidate 2 (TUSC2) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-09105P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Tumor Suppressor Candidate 2 (TUSC2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O75896
Target Symbol	TUSC2
Synonyms	C3orf11; Fus-1 protein; FUS1; Fusion 1 protein; LGCC; PAP; PDAP2; PDGFA associated protein 2; PDGFA-associated protein 2; Tumor suppressor candidate 2; TUSC 2; Tusc2; TUSC2_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Expression Range	1-110aa
Protein Length	Full Length
Mol. Weight	38.9kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
Protein Families	TUSC2 family
Database References	HGNC: 17034 OMIM: 607052 KEGG: hsa:11334 STRING: 9606.ENSP00000232496 UniGene: Hs.517981
Tissue Specificity	Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.

Gene Functions References

TUSC2P can suppresses the tumor function of esophageal squamous cell carcinoma by regulating TUSC2 expression and may also serve as a prognostic factor for esophageal squamous cell carcinoma patients. PMID: 30219035
these findings show that the combination of TUSC2-erlotinib induces additional novel vulnerabilities that can be targeted with Auranofin. PMID: 27845352
Data show that TUSC2 is a direct target of miR-584, which is transcriptionally regulated by TWIST1. PMID: 27661106
FOXP1, TP53INP1, TNFAIP3, and TUSC2 were identified as miR-19a targets. PMID: 26367773
The therapeutic activity of TUSC2 could extend the use of erlotinib to lung cancer patients with wildtype EGFR. PMID: 26053020
TUSC2P and TUSC2 3'-UTR expression inhibits cell proliferation, survival, migration, invasion and colony formation, and increases tumor cell death. TUSC2P and TUSC2 3'-UTR bind to miRNAs and arrest their functions, leading to increased TUSC2 translation. PMID: 24394498
The tumor suppressor gene TUSC2 (FUS1) sensitizes NSCLC to the AKT inhibitor MK2206 in LKB1-dependent manner. PMID: 24146957
RNA sequence elements in FUS1 UTRs that regulate FUS1 protein express were identified. PMID: 21645495
Absence of tumor suppressor FUS1 protein expression is associated with bone and soft tissue sarcomas. PMID: 21273575
Data show that the recombinant FUS1 plasmid has been successfully cloned, which allows highly efficient FUS1 expression in E.coli strain Rosetta (DE3)2 plys. PMID: 17545076
The goal of this study was to analyze possible involvement of TUSC2 in malignant pleural mesothelioma. PMID: 19852844
Myristoylation is required for Fus1-mediated tumor-suppressing activity and suggest a novel mechanism for the inactivation of tumor suppressors in lung cancer. PMID: 15126327
These results suggest that miR-378 enhances cell survival, tumor growth, and angiogenesis through repression of the expression of two tumor suppressors, Sufu and Fus-1. PMID: 18077375
FUS1 gene and Fus1 protein abnormalities could be used to develop new strategies for molecular cancer therapy for a significant subset of lung tumors. PMID: 18172250
These results suggest that the three miRNAs are negative regulators of Fus1 expression in lung cancers. PMID: 19671678
Overexpression of candidate tumor suppressor geneFUS1 isolated from the 3p21.3 homozygous deletionregion leads to G1 arrest and growth inhibition oflung cancer cells. PMID: 11593436

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.