Recombinant Human Tumor Suppressor Candidate 2 (TUSC2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09105P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Suppressor Candidate 2 (TUSC2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09105P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Suppressor Candidate 2 (TUSC2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O75896 |
| Target Symbol | TUSC2 |
| Synonyms | C3orf11; Fus-1 protein; FUS1; Fusion 1 protein; LGCC; PAP; PDAP2; PDGFA associated protein 2; PDGFA-associated protein 2; Tumor suppressor candidate 2; TUSC 2; Tusc2; TUSC2_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV |
| Expression Range | 1-110aa |
| Protein Length | Full Length |
| Mol. Weight | 38.9kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells. |
| Protein Families | TUSC2 family |
| Database References | HGNC: 17034 OMIM: 607052 KEGG: hsa:11334 STRING: 9606.ENSP00000232496 UniGene: PMID: 30219035 |
