Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) Protein (His-hFc), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) Protein (His-hFc), Active
Brand: Beta LifeScience
SKU: BLC-06080P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) Protein (His-hFc), Active is produced by our Mammalian cell expression system. This is a extracellular protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Uniprotkb	Q07011
Target Symbol	TNFRSF9
Synonyms	4 1BB; 4 1BB ligand receptor; 4-1BB ligand receptor; 4-1BB Ligand Receptor T Cell; 4-1BB, mouse, homolog of; Antigen 4-1BB Homolog; CD 137; CD137; CD137 antigen; CDw137; HLDA VI; Homolog of mouse 4 1BB; ILA; induced by lymphocyte activation (ILA); Induced by lymphocyte activation; Interleukin activated receptor homolog of mouse Ly63; Ly63, mouse, homolog of; MGC2172; OTTHUMP00000044294; Receptor protein 4 1BB; T cell antigen 4 1BB homolog; T cell antigen ILA; T-cell antigen 4-1BB homolog; T-cell antigen ILA; TNF receptor superfamily member 9; TNFRSF9; TNR9_HUMAN; Tumor necrosis factor receptor superfamily member 9
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His-hFc
Complete Sequence	LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Expression Range	24-186aa
Protein Length	Extracellular Domain
Mol. Weight	44 kDa
Research Area	Cancer
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Database References	HGNC: 11924 OMIM: 602250 KEGG: hsa:3604 STRING: 9606.ENSP00000366729 UniGene: PMID: 28755037 Herein, we present LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL that activates the CD40 and 4-1BB pathways, respectively PMID: 28536305 Tonic 4-1BB costimulation in chimeric antigen receptors impedes T cell survival and is vector-dependent. PMID: 28978471 Cetuximab-mediated NK-cell expression of CD137 on tumor-infiltrating lymphocytes is dependent on FcgammaRIIIa polymorphism. In neoadjuvant cetuximab-treated patients with head and neck cancer, upregulation of CD137 by intratumoral, cetuximab-activated NK cells correlated with FcgammaRIIIa V/F polymorphism and predicted clinical response. PMID: 27496866 In this study we systematically evaluated a series of CAR constructs targeting glypican-3 (GPC3), which is selectively expressed on several solid tumors. We compared GPC3-specific CARs that encoded CD3zeta (Gz) alone or with costimulatory domains derived from CD28 (G28z), 4-1BB (GBBz), or CD28 and 4-1BB (G28BBz). PMID: 27530312 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID: 27388616 the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID: 27430526 Egr2-driven cell surface proteins LAG-3 and 4-1BB can identify dysfunctional tumor antigen-specific CD8(+) TIL. PMID: 28115575 Findings indicate that CD137 antigen is a useful marker that can be used for identifying Mycobacterium tuberculosis (Mtb)-reactive CD4(+) T cells (Mtb-reactive CD4(+) T cells) by flow cytometry. PMID: 28218958 Anti-4-1BB single chain variable fragments enhanced surface CD69 expression and interleukin-2 production in stimulated CCRF-CEM cells which confirmed the agonistic effect of the selected single chain variable fragments. The data from this study have provided a rationale for further experiments involving the biological functions of anti-4-1BB single chain variable fragments in future studies. PMID: 28347235 Studies suggest that adoptive T cell therapy and CD137 antigen offer much opportunity to raise the efficacy of current cancer immunotherapies. PMID: 26970765 in complex with T cell receptor, promotes memory T cells, cell respiration, fatty acid oxidation and mitochondrial biogenesis PMID: 26885860 These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID: 26467721 Our findings provide a novel, TNFRSF9-positive, reactive astrocytic phenotype in human gliomas PMID: 24606203 Human genetic evidence for involvement of CD137 in atherosclerosis PMID: 25032953 As a result of becoming activated, transferred human T lymphocytes express the inducible surface antigens hPD-1 and hCD137 on their plasma membrane. PMID: 26113085 Our results provide biological explanations for the antitumor effects of CD19 CARs and for the observations that CD19 CAR T cells incorporating the 4-1BB costimulatory domain are more persistent than those incorporating CD28 in clinical trials. PMID: 25939063 upregulation of CD137 expression through LMP1 by EBV promotes cell survival in T or NK cells PMID: 25409517 Based on CD137 or CD154 expression. PMID: 25367298 High expression of CD137 is associated with type 1 diabetes. PMID: 24797972 DENV C disrupts Daxx and NF-kappaB interaction to induce CD137-mediated apoptosis during DENV infection PMID: 25019989 action of agonist anti-4-1BB in suppressing autoimmune and allergic inflammation was completely dependent on Galectin-9 (Gal-9). Gal-9 directly bound to 4-1BB, in a site distinct from the binding site of antibodies and the natural ligand of 4-1BB PMID: 24958847 A role for the TNFR-family member CD137 in the immunobiology of human cancer where it is preferentially expressed on tumor-reactive subset of tumor-infiltrating lymphocytes. PMID: 24045181 monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID: 24639347 findings show that immunohistochemistry for CD137L is capable of reliably distinguishing small B-cell lymphomas from reactive lymphoid aggregates PMID: 24746207 Dengue virus induces CD137 signaling to enhance apoptosis by increasing TNF-alpha production via activation of p38 MAPK. PMID: 23557259 this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast cancer cells PMID: 22797667 The CD137 multi-parameter flow cytometry fast assay allows for phenotypic and functional determination of alloreactive precursor frequencies of both CD4+ and CD8+ T cells with high sensitivity and specificity. PMID: 23750604 Co-stimulation through 4-1BB/CD137 improves the expansion and function of CD8(+) melanoma tumor-infiltrating lymphocytes for adoptive T-cell therapy. PMID: 23560068 Taken together, these data provide evidence that the 4-1BB signal is an important regulator of gammadelta T cells PMID: 23640752 the mechanisms that account for the effect of CD137 signaling on TNF-alpha production were based on a decrease of TNF-alpha production by antigen presenting cell (APC) and, perhaps, on the increase in APC apoptosis. PMID: 23437083 Our results reveal a new regulatory mechanism for CD137L expression that mediates immune escape by HRS cells, and they identify CD137 as a candidate target for immunotherapy of Hodgkin PMID: 23204227 Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID: 22204816 4-1BB (CD137), together with CD103, marks mesenteric lymph node dendritic cells (DC) with the highest level of retinal dehydrogenase (RALDH) activity, and ligation of 4-1BB maintains RALDH expression in these gut DC. PMID: 22896640 CD137 protein is expressed by a select group of hematolymphoid tumors, including classical Hodgkin lymphoma, T-cell and NK/T-cell lymphomas, and follicular dendritic cells neoplasms. PMID: 22901750 treatment with CD137 agonistic antibody induces CCL21 expression and DC accumulation close to lymphatic vessels. Collectively, our results demonstrate that the inflammatory function of lymphatic vessels can be regulated by CD137. PMID: 22593548 CD137:CD137L interactions regulate the innate and adaptive immune response of the host against M. tuberculosis PMID: 21747409 significantly positive correlation between CD137 expression and complex coronary stenosis morphology PMID: 21396356 Data indicate that 4-1BBL mediates NK-cell immunosubversion in CLL, and thus might contribute to the reportedly compromised efficacy of Rituximab to induce NK-cell reactivity in the disease. PMID: 22144129 CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID: 22343199 We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID: 22282196 The sCD137 levels correlate with the probability of complications and lethality. The association of sCD137, a product of activated T cells, with the severity of acute pancreatitis suggests that T cells contribute to the pathogenesis of acute pancreatitis. PMID: 21963611 CD137 has a role in breast cancer and its specific antibody can be used to enhance trastuzumab efficacy PMID: 22326955 conditioned medium from Lewis Lung Carcinoma cells caused significant upregulation of 4-1BB in mast cells PMID: 22343053 Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID: 21745658 The measurement of a single gene expressed by tumor cells (LMO2) and a single gene expressed by the immune microenvironment (TNFRSF9) powerfully predicts overall survival in patients with diffuse large B-cell lymphoma. PMID: 21670469 This work is the first to demonstrate the contribution of CD137 signaling to DENV-mediated apoptosis. PMID: 21669186 CD137 ligand can also be expressed as a transmembrane protein on the cell surface and transmit signals into the cells on which it is expressed (reverse signaling). PMID: 20643812 Results suggest with a two-step model of M cell differentiation, with initial CD137-independent commitment to the M cell lineage followed by CD137-CD137L interaction of M cells with CD137-activated B cells or dendritic cells for functional maturation. PMID: 20616340 Data support a role for CD137 in the recruitment of monocytes to inflammatory tissues. PMID: 20347151

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) Protein (His-hFc), Active

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) Protein (His-hFc), Active

Product Overview

Target Details

FAQs