Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 8 (TNFRSF8) Protein (His&Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05824P
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 8 (TNFRSF8) Protein (His&Myc), Active
Beta LifeScience
SKU/CAT #: BLC-05824P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins, Recombinant cell therapy targets for car-t research
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 8 (TNFRSF8) Protein (His&Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L, the EC 50 is 14.96-20.25 ng/ml. |
| Uniprotkb | P28908 |
| Target Symbol | TNFRSF8 |
| Synonyms | TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-10His&C-Myc |
| Target Protein Sequence | FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK |
| Expression Range | 19-379aa |
| Protein Length | Partial |
| Mol. Weight | 43.5 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B. |
| Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. |
| Database References | HGNC: 11923 OMIM: 153243 KEGG: hsa:943 STRING: 9606.ENSP00000263932 UniGene: PMID: 29470552 |
