Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 8 (TNFRSF8) Protein (His&Myc), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 8 (TNFRSF8) Protein (His&Myc), Active
Brand: Beta LifeScience
SKU: BLC-05824P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L, the EC 50 is 14.96-20.25 ng/ml. Biological Activity Assay

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality recombinant proteins, Immune checkpoint proteins, Recombinant cell therapy targets for car-t research

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 8 (TNFRSF8) Protein (His&Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L, the EC 50 is 14.96-20.25 ng/ml.
Uniprotkb	P28908
Target Symbol	TNFRSF8
Synonyms	TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	N-10His&C-Myc
Target Protein Sequence	FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Expression Range	19-379aa
Protein Length	Partial
Mol. Weight	43.5 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
Subcellular Location	[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm.
Database References	HGNC: 11923 OMIM: 153243 KEGG: hsa:943 STRING: 9606.ENSP00000263932 UniGene: PMID: 29470552 The stable elevation in classical Hodgkin lymphoma risk with elevated levels of sCD30 and IL6 across 4 or more years prior to diagnosis may also reflect a B-cell-stimulatory environment that promotes the genesis of these cancers. PMID: 28341757 extranodal NK/T-cell lymphoma, nasal type(ENKTL) is the most common type of mature T-cell and NK-cell lymphoma diagnosed at our institution. CD30 is frequently expressed in ENKTL and represents a therapeutic target; however, it may not be a prognostic marker. PMID: 28486951 This study suggests that in patients with CD30+ lymphoproliferative disorders, an aggressive clinical course cannot be defined by the presence of TP63 rearrangements, as was recently shown in systemic ALK negative anaplastic large cell lymphoma. PMID: 27146432 Data suggest that Brentuximab Vedotin (SGN-35) damaged CD30 ligand (CD30L)-immune cells through CD30 extracellular vesicles (EVs). PMID: 27105521 median FoxP3+ Treg count was higher in CD30+ than in CD30- posttransplant lymphoproliferative disorders, 3.0 vs 0 PMID: 29126177 Variant histology is common in pediatric NLPHL, especially types C and E, which are associated with IgD expression. Type C variant histology and possibly type D are associated with decreased EFS, but neither IgD nor CD30 are adverse features. Variant histology may warrant increased surveillance, but did not affect overall survival. PMID: 28802087 Expression of CD30 in patients with both DLBCL and other aggressive B-cell lymphomas and the absence of MYC oncogene-driven proliferation in the majority of these tumors suggests that brentuximab may be a particularly effective form of targeted therapy in the subset of patients with high CD30 expression. PMID: 27521276 Prevalence of the CD30 (Ki-1) antigen in human solid tumors was summarized. PMID: 28427526 Higher serum sCD30 levels were associated with an increased risk of bacterial infection after kidney transplantation. PMID: 28122147 CD30 expression was detected in up to 25% of cases of diffuse large B-cell lymphoma and was more frequent in tumors without MYC rearrangement. CD30 expression was not associated with overall survival in R-EPOCH-treated de novo DLBCL patients. PMID: 27816715 CD30 facilitates phosphorylation of heat shock factor 1, activates heat shock promoter element, and induces heat shock protein (HSP) 90. PMID: 27870927 this study shows that polyclonal and allogeneic stimulation induced higher levels of CD30 transcripts in end-stage renal disease patients compared to control patients PMID: 26970513 CD30 expression was not associated with prognosis in our cohort of de novoDLBCL, including in patients who received aggressive chemotherapy. CD30 expression and MYC rearrangement were mutually exclusive in de novoDLBCL. PMID: 26340843 Case Report: CD30 positive lymphomatoid papulosis arising in association with cutaneous amyloidosis in a patient with multiple myeloma. PMID: 26981738 The heterogeneity of CD30 expression in refractory or relapsed peripheral T-cell lymphoma patients indicates the likelihood for better response for patients with strong CD30 expression by tumor cells. PMID: 26703966 CD30 may be useful as a prognostic marker in rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) treated DLBCLs, indicating favorable outcomes in a Chinese population. PMID: 26884853 this review is focused on the role of CD30 receptor and p53 as novel targets for therapy in ALK+ ALCL, and also provides an update on their potential involvement in ALK+ ALCL pathogenesis PMID: 26709646 Most angioimmunoblastic T-cell lymphoma and peripheral T-cell lymphoma-not otherwise specified express variable levels of CD30. PMID: 26574847 Upregulated expression of CD30 is commonly found in sclerosing angiomatoid nodular transformation of the spleen. PMID: 26261484 Our results demonstrated significantly elevated sCD30 levels in AS patients compared to healthy controls (HCs) with mean values of 32.0 +/- 12.2 and 24.9 +/- 8.0 ng/mL, (P(**) = 0.007), suggesting a p role of sCD30 in the pathogenesis of AS. PMID: 26273636 With the introduction of the immunoconjugate brentuximab vedotin, the CD30 antigen has become an effectively targetable molecule. Therefore, we investigated the frequency and level of CD30 expression in post-transplant lymphoproliferative disorders. PMID: 25248878 Data susggest that CD30 antigen may be useful as a prognostic factor and therapeutic target in extranodal natural killer/T-cell lymphoma (NKTCL). PMID: 25288491 Data indicate that CD30 antigen downregulation and P-Glycoprotein (MDR1) upregulation are associated with drug resistance to brentuximab vedotin. PMID: 25840583 Intralymphatic variant of ALCL and LyP may be explained, at least in part, by a particular lymphotropism of the neoplastic cells of cutaneous CD30 lymphoproliferative disorders. PMID: 26371781 BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T cell lymphoma cases co-expressing the CD30 antigen. PMID: 24492285 These results show that high sCD30 levels are independent predictors of graft dysfunction PMID: 25698648 Single threonine residue at position 61 in CD30v that is critical for TRAF2 interaction, NFkappaB activation, and downstream CD30-NFkappaB-dependent phenotypes in hESCs was identified. PMID: 25568342 Case Report: describe a CD30+ lymphoproliferative rash exhibiting a predilection for recurrence on the same skin sites. PMID: 24733405 case Report: primary cutaneous CD30+ anaplastic large cell lymphoma treated successfully with brentuximab vedotin. PMID: 24733422 Elevated serum sCD30 is associated with increased risk of non-Hodgkin lymphoma. PMID: 25567136 Case Report: suggest Sezary syndrome, CD30 anaplastic large-cell lymphoma, and mycosis fungioides are interrelated. PMID: 25548993 levels of serum sCD30 tend to be higher in individuals with atopy. Improvement in lung function seems to be associated with a decrease in sCD30 in children with atopy and troublesome lung symptoms. PMID: 25492095 occurs in a significant subset of angiosarcomas and epithelioid hemangioendotheliomas PMID: 24805132 findings uncover the oncogenic role of the JUNB/CD30 axis and its potential as therapeutic target in ALK+ ALCL. PMID: 25145835 Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders. PMID: 25349176 is expressed in a substantial proportion of DLBCL and CD30 immunohistochemistry may be a useful prognostic marker in R-CHOP treated GCB-DLBCL. PMID: 25135752 The expression of CD30 by mastocytosis mast cells may influence the clinical phenotype and management of mastocytosis. (Review) PMID: 24745678 a substantial subset of patients with T-ALL have lymphoblasts that express surface CD30. CD30 expression by T-lymphoblasts also appears to be up-regulated in patients who are treated with high-dose chemotherapy. PMID: 23937105 Suggest intralymphatic cutaneous anaplastic large cell lymphoma/lymphomatoid papulosis are part of an expanding spectrum of CD30-positive lymphoproliferative disorders. PMID: 24805854 higher serum levels in Ewing sarcoma patients with primary bone tumors PMID: 24375064 diagnostic and prognostic value of CD30 expression in systemic mastocytosis as assessed by multiparameter flow cytometry PMID: 24111625 this study highlights a novel SATB1-p21 axis that plays an important role in the disease progression of cutaneous CD30+LPDs, which provides novel molecular insights into this disease and possibly leads to new therapies in the future. PMID: 24747435 serum concentration during pregnancy is not associated with pre-eclampsia and recurrent pregnancy loss PMID: 23268289 CD30 expression on lymphomatous cells makes an attractive target for drug-conjugated antibody-directed therapies. PMID: 23716537 CD30(+) peripheral T-cell lmyphomas differed significantly from CD30(-) samples. PMID: 23716562 Post-transplant sCD30 serum levels, especially in conjunction with information regarding HLA class II antibodies and serum creatinine levels, provide valuable information regarding graft outcome PMID: 23928467 Malignant Hodgkin and Reed-Sternberg cells release CD30 on the surface of extracellular vesicles facilitating CD30-CD30L interaction between cell types. PMID: 24659185 High pretransplant levels of serum soluble CD30 can be a risk factor for kidney transplant rejection, and its high negative predictive value at various cutoffs make it useful to find candidates with a low risk of acute rejection after transplant. PMID: 23477385 Soluble CD30 levels are significantly reduced in combination immunosuppression but are differentially affected by different immunosuppressant agents. PMID: 23503451

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.