Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-05700P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Car-nk targets proteins, Cluster of differentiation (cd) proteins, Co-stimulatory receptors, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His), Active is produced by our Mammalian cell expression system. This is a extracellular protein.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 100 ug/ml.
Uniprotkb	P25942
Target Symbol	CD40
Synonyms	CD40; TNFRSF5; Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-6His
Complete Sequence	EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Expression Range	21-193aa
Protein Length	Extracellular Domain
Mol. Weight	20.2 kDa
Research Area	Immunology
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.
Subcellular Location	[Isoform I]: Cell membrane; Single-pass type I membrane protein.; [Isoform II]: Secreted.
Database References	HGNC: 11919 OMIM: 109535 KEGG: hsa:958 STRING: 9606.ENSP00000361359 UniGene: PMID: 29549140 the CD40 rs1883832 T allele acts as a risk factor for increased susceptibility to sepsis and may be involved in the process of sepsis through regulation of CD40 expression and plasma sCD40L levels. PMID: 29780830 The 3'-UTR CD40LG (CA)n microsatellite is not a genetic marker for rheumatoid arthritis in western Mexican population; however, results suggest that it plays a role in the CD40LG mRNA expression. PMID: 28963582 Herein, we present LOAd703, a designed adenovirus armed with trimerized CD40L and 4-1BBL that activates the CD40 and 4-1BB pathways, respectively PMID: 28536305 Inducible activation of MyD88 and CD40 in CAR T cells with a small-molecule drug not only enhances their effector function, resulting in potent antitumor activity in preclinical solid tumors, but also enables their remote control post infusion. PMID: 28801306 that the rs3765459 variant in CD40 gene is associated with susceptibility to neuromyelitis optica spectrum disorders. PMID: 27578014 We disclosed the association of different CD40 SNPs with Graves disease and Hashimoto's Thyroiditis susceptibility in Chinese patients. This suggests that there might be several different susceptibility loci for autoimmune thyroid diseases (AITD) within CD40, each contributing a different effect in the onset and development of AITDs. PMID: 28742400 CD40 gene rs4810485 and rs1883832 mutations investigated in Recurrent aphthous stomatitis patients. PMID: 27875792 these data demonstrated that miR-145-5p may function as a cardiac-protective molecule in myocardial ischemic injury by ameliorating inflammation and apoptosis via negative regulation of CD40. PMID: 28281187 rs4810485 G>T and rs1883832 C >T SNPs in the CD40 gene may be associated with disease susceptibility and severity in knee osteoarthritis in the Chinese Han population. PMID: 28320398 miR-145 is involved in the anti-proliferation and anti-inflammation effects of aspirin on vascular smooth muscle cells by inhibiting the expression of CD40. PMID: 27412561 selective knockdown of TNFR5 ameliorates glucolipotoxic induction of STAT1 expression and NF-kappaB activity. PMID: 27512950 CD40 signaling in adipose tissue macrophages regulates major histocompatibility complex class II and CD86 expression to control the expansion of CD4(+) T cells. PMID: 26658005 CD40 activation resulted in down-regulation of Thioredoxin (Trx)-1 to permit ASK1 activation and apoptosis. Although soluble receptor agonist alone could not induce death, combinatorial treatment incorporating soluble CD40 agonist and pharmacological inhibition of Trx-1 was functionally equivalent to the signal triggered by mCD40L. PMID: 27869172 autologous CD4(+) T cells that are exposed to EVs from CD40/IL-4-stimulated CLL cells exhibit enhanced migration, immunological synapse signaling, and interactions with tumor cells. PMID: 27118451 Cytokine expression upon simultaneous stimulation of TSHR and CD40 is greater than levels achieved with TSH or CD40L alone. Increased expression of CD40 by TSH is a potential mechanism for this process PMID: 27631497 glatiramer acetate treatment also significantly reduced CD40-mediated P65 phosphorylation in RRMS patients, suggesting that reducing CD40-mediated p-P65 induction may be a general mechanism by which some current therapies modulate Multiple Sclerosis disease. PMID: 27798157 Circulating sCD40L levels are increased in patients with cystic fibrosis and P. aeruginosa infection PMID: 28030642 Our results support an important association of rs4810485 in CD40 gene and rs763361 in CD226 gene polymorphism, combined effect of rs4810485 and rs763361 with increased risk of systemic lupus erythematosus. PMID: 27722794 CD40 activity in thyrocytes is prominently mediated via NF-kappaB. PMID: 27929668 polymorphisms in the TP63 and CD40 genes are associated with lung cancer in a Chinese Han population PMID: 27063419 Increased CD40 ligation and reduced B-cell receptor signalling leads to higher IL-10 production in B Cells from tolerant kidney transplant recipients. PMID: 27472092 Essential hypertension patients showed increased expression of platelet CD40. PMID: 27090943 CD40 monocyte is a novel inflammatory monocyte subset that could be used as a biomarker for chronic kidney disease severity. PMID: 27992360 rs1535045 in CD40 gene is likely to be associated with Coronary Artery Disease (CAD) in the Chinese Han population; rs4239702(C)-rs1535045(T) haplotype is associated with CAD. the blood lipid level of patients with rs4239702-TT genotype was higher than other patients PMID: 27200368 These results suggest that the CD40 SNPs rs1883832 and rs4810485 are not RA susceptibility markers in the western Mexican population. Further studies are needed to clarify their roles in CD40 mRNA expression. PMID: 27813548 functional expression of CD40 on tumor cells might play an important role in tumor progression and lymph node metastasis in esophageal squamous cell carcinoma PMID: 27630283 It is likely that the CD40/CD40L interactions and TNF alpha are effective against cervical carcinomas by repressing transcriptional activity of human papilloma virus-18 promoter. PMID: 27031714 we demonstrate that antigen targeting to CD40 can evoke potent antigen-specific CD8(+) T cell responses in human CD40 transgenic mice PMID: 27077111 Our findings suggest that the CD40 -1C/T SNP (rs1883832) is correlated with the susceptibility to lung cancer in Chinese, and the TT genotype may further increase the risk of lung cancer. PMID: 26823861 CD40/CD40L system plays a role in regulating bone mineral density. PMID: 26545336 There were significant differences in the gene and allele frequencies of CD40 gene rs1883832 C/T polymorphism between the patients with systemic lupus erythematosus and controls. sCD40 levels were increased in patients with SLE compared with controls PMID: 26289938 Study provides preliminary evidence that CD40 may stimulate tumor growth by enabling immune evasion via MDSC recruitment and inhibition of T cell expansion. PMID: 26462153 our results highlight new roles for CD40 and cysteine-238-mediated CD40 homodimers in cell biology and identify a potential new target for therapeutic strategies against CD40-associated chronic inflammatory diseases. PMID: 25977307 meta-analyses confirm that the CD40 rs4810485 G/T polymorphism is associated with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in Europeans. PMID: 25908480 Platelet CD40 plays a crucial role in inflammation by stimulating leukocyte activation and recruitment and activation of endothelial cells, thereby promoting atherosclerosis. PMID: 26821950 CD40 gene may play a role in the development of systemic lupus erythematosus in the Chinese population. PMID: 26474561 Studies suggest that the CD40 antigen/CD154 antigen pathway represents a promising potential therapeutic target for the prevention of transplantation rejection. PMID: 26268734 study shows a multiple sclerosis(MS)risk genotype-dependent reduction of CD40 cell-surface protein in B-lymphocytes and polarised dendritic cells; MS patients, regardless of genotype, express lower levels of CD40 cell-surface protein compared to controls in B lymphocytes; both genotype-dependent and independent downregulation of cell-surface CD40 is a feature of MS PMID: 26068105 the ability of IL21 to modulate gene and miRNA expressions in CD40-activated Chronic Lymphocytic Leukemiacells, was studied. PMID: 26305332 the direct CD40-CD40L interaction of breast tumor cells and activated T cells increases TGF-beta production and the differentiation of Th17 cells, which promotes the proliferation of breast cancer cells PMID: 25992978 Differences in the expression levels of CD40 because of different genotypes of these two SNPs (rs4810485 and rs1883832) may take part in the development of skin lesions or genital ulcers in patients with Behcet disease. PMID: 25373542 CD40 rs1883832C>T SNP decreases gene CD40 expression. PMID: 25600834 The presence of CD40 on T cell membrane is crucial for induction of recombinase activity in patients with autoimmune type 1 diabetes mellitus. PMID: 22803080 CD40 expression is significantly correlated with the TNM stage and the presence of distant metastasis in gastric carcinoma patients. PMID: 25665853 CD40 signaling led to sustained ERK1/2 activation and up-regulation of Bcl-xL in BCR-primed HF1A3 germinal center B cells. PMID: 26054744 subjects with the chronic hepatitis B (CHB) risk genotype TT of rs1883832 had the lowest plasma concentration of CD40, followed by subjects with CT and CC genotypes in both healthy controls and CHB patients PMID: 25802187 On the surface of B lymphocytes, the CD40 expression levels in the individuals with TT genotype were significantly lower than those with CC and CT genotypes in either ASC group or healthy controls. PMID: 25547203 A possible additive combined effect between CD40-1C>T and CTLA4+6230G>A polymorphisms in the development of Graves' disease. PMID: 25936345 There is lack of association between CD40 polymorphisms and acute rejection in German liver transplant recipients. PMID: 25305459

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His), Active

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Protein (His), Active

Product Overview

Target Details

FAQs