Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (hFc), Active

Beta LifeScience SKU/CAT #: BLC-05623P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (hFc), Active

Beta LifeScience SKU/CAT #: BLC-05623P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 10 ug/ml.
Uniprotkb P43489
Target Symbol TNFRSF4
Synonyms TNFRSF4; TXGP1L; Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-hFc
Complete Sequence LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Expression Range 29-216aa
Protein Length Partial
Mol. Weight 46.8 kDa
Research Area Cancer
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.; (Microbial infection) Acts as a receptor for human herpesvirus 6B/HHV-6B.
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References

HGNC: 11918

OMIM: 600315

KEGG: hsa:7293

STRING: 9606.ENSP00000368538

UniGene: PMID: 29661166

  • Increased OX40 expression is associated with gastric cancer. PMID: 29529339
  • this study demonstrates that cSCCs contain an abundance of Tregs which can suppress tumoral effector T cell function and that activation of the costimulatory receptor OX40 enhances tumoral T cell responses. PMID: 27034329
  • OX40 expression on T cells was positively associated with obesity in humans. PMID: 28612217
  • Metabolically active CD4+ T cells expressing Glut1 and OX40 preferentially harbor HIV during in vitro infection. PMID: 28892135
  • this study investigated whether CD134 is preferentially expressed on CD4 T cells in drug-induced hypersensitivity syndrome . PMID: 27174092
  • blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID: 26872462
  • Low OX40 expression is associated with colorectal cancer. PMID: 26439988
  • OX40 and its ligand are co stimulators for T lymphocytes. PMID: 26755473
  • These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID: 26467721
  • Malaria patients and Plasmodium-infected rodents exhibit enhanced expression of the co-stimulatory receptor OX40 on CD4 T cells, which is abrogated following coordinate PD-1 co-inhibitory pathways, which are also upregulated during malaria. PMID: 25891357
  • Identified two key amino acid residues within CD134 that are required for its interaction with herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to CD134. PMID: 26202244
  • TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells PMID: 25148371
  • High expression of OX40 is associated with type 1 diabetes. PMID: 24797972
  • A cysteine-rich domain of CD134 that is critical for binding to the HHV-6B glycoprotein gH/gL/gQ1/gQ2 complex and HHV-6B infection. PMID: 25008928
  • cirrhotic and hepatocellular carcinoma fragments moderately and highly infiltrated by Tregs, respectively, expressing OX40 PMID: 24756990
  • data show that Ag-specific CD4(+) CD25(+) CD134(+) CD39(+) T cells are highly enriched for Treg cells, form a large component of recall responses and maintain a Treg-cell-like phenotype upon in vitro expansion. PMID: 24752698
  • expression is associated with breast cancer in a stage dependent manner PMID: 23502335
  • OX40 signals regulate CD8 T cell survival at least in part through maintaining expression of the anti-apoptotic molecule A1 PMID: 23936461
  • Hyperactivation of the Akt pathway in Teff cells from children with lupus nephritis is associated with reduced induction of TRAF6 and up-regulation of OX40, which may cause Teff cell resistance to Treg cell-mediated suppression. PMID: 23896866
  • This study identified OX40 as a key molecule and biomarker for rapid progression of HTLV-1-associated myelopathy/tropical spastic paraparesis. PMID: 23651542
  • CD134 is a cellular receptor specific for human herpesvirus-6B entry. PMID: 23674671
  • Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID: 22204816
  • CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID: 22343199
  • We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID: 22282196
  • PAPP-A level was significantly related to soluble and membrane-bound OX40L in patients with ACS. PMID: 21111564
  • Compared with control group, the expression of OX40 and Bcl-2 was significantly higher in allergic rhinitis. PMID: 19253527
  • Transgenic OX40 forms a signaling complex in T cells that contains phosphoinositide 3-kinase (PI3K) and protein kinase B (PKB). PMID: 21289304
  • High OX40 expression may be associated with malignant transformation, progression, invasion and metastasis in breast cancer biology. PMID: 20634005
  • Possible proinflammatory effects of OX40L on the pathogenesis of atherosclerois. PMID: 21086790
  • This study has shown that activation of OX40 induces CCL20 expression in the presence of antigen stimulation. PMID: 20400327
  • The rs2298212G/A polymorphism in OX40 gene may be associated with the severity of coronary atherosclerotic disease. PMID: 20376799
  • Data suggest the role of Perforin + cytotoxic T lymphocytes and CD134+ cells in the pathogenesis of autoimmunity of SLE. PMID: 20306696
  • Pimecrolimus inhibits up-regulation of OX40 and synthesis of inflammatory cytokines upon secondary T cell activation by allogeneic dendritic cells. PMID: 12296857
  • CD134 positive cells are identified within inflammatory lesions of active multiple sclerosis (MS), acute MS and chronic active MS as well as in acute disseminated leukoencephalitis patients. PMID: 14644025
  • Mutagenesis showed that Asp60 and Asp62 are required for interaction with FIV, and modeling studies localized these two residues to the outer edge of domain 1 PMID: 15592478
  • The expression of CD134 was markedly higher, compared to CD137, both on the day of the surgery and ten days after colorectal cancer surgery. PMID: 15638367
  • Deficiencies in OX40 and CD30 signals were additive, secondary Ab responses were ablated.OX40/CD30 double-knockout OTII transgenic T cells fail to survive compared with normal T cells when cocultured with CD4(+)CD3(-) cells in vitro. PMID: 15778343
  • Decrease in OX40 expression posttransplant includes the defective reconstitution of Treg cells, and the active inhibition of gene transcription by cyclosporine. PMID: 15808546
  • stimulation of OX40/4-1BB rendered cells sensitive to apoptosis induced by TNF-alpha and reduced activation of NF-kappaB. OX40/4-1BB stimulation repressed the mitogen response in activated CD25+CD4+ T cells and preactivated CD8+ T cells PMID: 15941918
  • CD3+ T lymphocytes co-expressing CD134 and CD137 antigens on peripheral blood revealed an increased percentages of OX-40/CD137 positive cells in patients with Graves' disease (p<0.025) compared to the controls. PMID: 16232366
  • The relevance of these findings is supported by the vital functions fulfilled by OX40 in mammals as reflected by the high level of evolutionary conservation. PMID: 16329997
  • The coexpression of CD25 and the costimulatory molecule CD134 on memory T-cells provides a novel marker for type 1 diabetes-associated T-cell immunity. PMID: 16380476
  • OX40 ligation on CD4(+) T cells represents a potentially novel immunotherapeutic strategy that should be investigated to treat and prevent persistent virus infections, such as HIV-1 infection. PMID: 16456009
  • OX40 is induced transiently on CD8(+) T cells upon activation and its signals contribute to both clonal expansion and functional reinforcement PMID: 16750861
  • In the present study we found that costimulation via OX40 and TNF-R in OX40-expressing HIV-1-infected T cell lines leads to a marked reduction of HIV-1 production associated with rapid cell death. PMID: 18327975
  • The expression of OX40 on CD4+ T cells in sentinel lymph nodes draining primary melanomas decreased withe more advanced tumor features, suggesting an immunosuppressive effect. PMID: 18374895
  • Activity of OX40 ligand is enhanced by oligomerization and cell surface immobilization. PMID: 18397322
  • the frequency of the most frequent haplotype, C-C-A-A, was significantly lower and that of the second most frequent, C-T-G-A, was significantly higher in hypertensive subjects than in controls. This difference was observed only in female patients PMID: 18398332
  • These data offer a novel approach for UCB Treg expansion using aAPCs, including those coexpressing OX40L or 4-1BBL. PMID: 18645038
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed