Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-07962P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-07962P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B (TNFRSF1B) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P20333 |
| Target Symbol | TNFRSF1B |
| Synonyms | CD120b; p75; p75 TNF receptor; p75TNFR; p80 TNF alpha receptor; p80 TNF-alpha receptor; Soluble TNFR1B variant 1; TBP-2; TBPII; TNF R II; TNF R2; TNF R75; TNF-R2; TNF-RII; TNFBR; TNFR-II; TNFR1B; TNFR2; TNFR80; TNFRII ; Tnfrsf1b; TNR1B_HUMAN; Tumor necrosis factor beta receptor; Tumor necrosis factor binding protein 2; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor type II; Tumor necrosis factor-binding protein 2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST |
| Expression Range | 27-203aa |
| Protein Length | Partial |
| Mol. Weight | 46.3kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. |
| Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted. |
| Database References | HGNC: 11917 OMIM: 191191 KEGG: hsa:7133 STRING: 9606.ENSP00000365435 UniGene: PMID: 29748156 |
