Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B Protein (TNFRSF1B), Active
Beta LifeScience
SKU/CAT #: BLC-06037P
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B Protein (TNFRSF1B), Active
Beta LifeScience
SKU/CAT #: BLC-06037P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1B Protein (TNFRSF1B), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 97% as determined by SDS-PAGE and HPLC. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-α mediated cytotoxicity in the L-929 cells is less than 0.2 μg/ml, corresponding to a specific activity of >5000 IU/mg in the presence of 0.25 ng/mL of rHuTNF-α. |
| Uniprotkb | P20333 |
| Target Symbol | TNFRSF1B |
| Synonyms | CD120b; p75; p75 TNF receptor; p75TNFR; p80 TNF alpha receptor; p80 TNF-alpha receptor; Soluble TNFR1B variant 1; TBP-2; TBPII; TNF R II; TNF R2; TNF R75; TNF-R2; TNF-RII; TNFBR; TNFR-II; TNFR1B; TNFR2; TNFR80; TNFRII ; Tnfrsf1b; TNR1B_HUMAN; Tumor necrosis factor beta receptor; Tumor necrosis factor binding protein 2; Tumor necrosis factor receptor 2; Tumor necrosis factor receptor superfamily member 1B; Tumor necrosis factor receptor type II; Tumor necrosis factor-binding protein 2 |
| Species | Homo sapiens (Human) |
| Expression System | E.Coli |
| Tag | Tag-Free |
| Complete Sequence | M+PAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
| Expression Range | 24-206aa |
| Protein Length | Partial |
| Mol. Weight | 20.0 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | 0.2 μm filtered PBS, pH 7.4, lyophilized |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. |
| Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.; [Tumor necrosis factor-binding protein 2]: Secreted. |
| Database References | HGNC: 11917 OMIM: 191191 KEGG: hsa:7133 STRING: 9606.ENSP00000365435 UniGene: PMID: 29748156 |
