Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1A (TNFRSF1A) Protein (His), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1A (TNFRSF1A) Protein (His), Active
Brand: Beta LifeScience
SKU: BLC-06056P
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Collections: All products, Buy cytokines, chemokines, and growth factors for research online, High-quality cytokines for advanced research, High-quality recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1A (TNFRSF1A) Protein (His), Active is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D.-
Uniprotkb	P19438
Target Symbol	TNFRSF1A
Synonyms	CD120a; FPF; MGC19588; p55; p55-R; p60; TBP1; TBPI; TNF R; TNF R55; TNF-R1; TNF-RI; TNFAR; TNFR-I; TNFR1; TNFR55; TNFR60; TNFRI; TNFRSF1a; TNR1A_HUMAN; Tumor necrosis factor receptor 1; Tumor necrosis factor receptor superfamily, member 1A; Tumor necrosis factor receptor type 1; Tumor necrosis factor receptor type I; Tumor necrosis factor-binding protein 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Complete Sequence	IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
Expression Range	22-211aa
Protein Length	Partial
Mol. Weight	23.5 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.

Target Details

Target Function	Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Subcellular Location	Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Secreted. Note=A secreted form is produced through proteolytic processing.; [Isoform 4]: Secreted. Note=Lacks a Golgi-retention motif, is not membrane bound and therefore is secreted.
Database References	HGNC: 11916 OMIM: 142680 KEGG: hsa:7132 STRING: 9606.ENSP00000162749 UniGene: PMID: 28256549 It has been demonstrated that the molecular genetic marker +36G TNFR1 (OR=1,25) is involved in the formation Essential Hypertension in individuals with Metabolic Syndrome. PMID: 30289218 Due to the fact that the mutation was not inherited from the parents, it was likely that R426L was a de novo and novel mutation in the TNFRSF1A gene, which can trigger TRAPS or TRAPS-like symptoms. PMID: 27793577 this study evaluated TNFR1 -609G/T polymorphisms association with RA susceptibility in a sample of Mexican patients. Our results suggest that the TNFR1 -609G/T polymorphisms are not associated with RA susceptibility in a sample of Mexican patients. PMID: 29404828 Polymorphisms in the TNFR1 gene may have an impact on the symptomatology of schizophrenia in men. rs4149577 and rs1860545 SNPs were associated with the intensity of the Positive and Negative Syndrome Scale (PANSS) excitement symptoms in men, which may contribute to the risk of violent behavior. PMID: 29317797 Polymorphism of Promoter Region of TNFRSF1A Gene is associated with Radiotherapy Induced Oral Mucositis in Head and Neck Cancer. PMID: 28401452 five single nucleotide polymorphisms in the TNFRSF1A gene are not associated with autoimmune thyroid diseases in the Chinese Han population, but rs4149570 shows a weak association with Hashimoto's thyroiditis after adjusting for gender and age. PMID: 29401539 Genotype rs767455 was associated with the susceptibility of ankylosing spondylitis(AS), G allele of rs767455 exhibited an association with the risk of developing AS. Only rs1061622 was significantly associated with long-term efficacy of etanercept. The results suggest that TNFRSF1A and TNFRSF1B polymorphisms were associated with susceptibility, severity, and the long-term therapeutic efficacy of etanercept of AS patients. PMID: 30075559 RACK1 associates with MOAP-1 via electrostatic associations similar to those observed between MOAP-1/RASSF1A and MOAP-1/TNF-R1. These events illustrate the complex nature of MOAP-1 regulation and characterizes the important role of the scaffolding protein, RACK1, in influencing MOAP-1 biology. PMID: 29470995 serum level did not decrease significantly after tonsillectomy with steroid pulse therapy in IgA nephropathy PMID: 28389814 The TNFRSF1A c.625+10 G allele was associated with late response to anti-TNFalpha therapy but TNFRSF1A gene SNPs is not associated with spondyloarthritis. PMID: 29579081 TNFR1 is associated longitudinally with kidney function decline but not with myocardial infarct, heart failure, or mortality risk after adjustment PMID: 28601698 One third of our childhood MS patients had a heterozygous mutation in the TNFRSF1A and/or MEFV gene. This proportion by far exceeds the number of mutations expected and was higher than in adult MS patients, suggesting that these mutations might contribute to the pathogenesis of childhood MS. PMID: 28927886 Studied the association of NLR family pyrin domain containing 3 (NLRP3) and tumor necrosis factor receptor superfamily member 1A (TNFRSF1A) polymorphisms and haplotypes in patients with ankylosing spondylitis (AS) and treatment response to etanercept. PMID: 28116820 Investigations of underlying molecular mechanisms of TNFR1 signaling showed that PDF affects TNFR1 signaling at the proapoptotic signaling pathway by upregulation of IkappaBalpha and downregulation of cFLIPL. PMID: 28096440 Case Report: tumor necrosis factor receptor-associated periodic syndrome due to the R92Q TNFRSF1A variant associated with recurrent pericarditis and cardiac tamponade. PMID: 27990755 Serum TNFR1 is a biomarker for patients with chronic kidney disease. PMID: 28667032 This study demonstrated that TNFR1 expression levels are related to major depressive disorder and conjunctly mediate the effect of childhood maltreatment history on the risk of developing major depressive disorder. PMID: 28384542 SNP (36A>G) is strong risk factor for odontogenic keratocystic tumor PMID: 28199753 Data suggest that Fas and TNFR1 are involved in glaucoma mechanisms in cornea; pro-apoptotic effect of anti-glaucoma medication clonidine on corneal epithelial cells triggers Fas/TNFR1-mediated, mitochondria-dependent signaling pathway. (Fas = Fas cell surface death receptor ; TNFR1 = TNF receptor superfamily member 1A) PMID: 28115640 These results indicate that TNFRI-Fc and hHO-1 overexpression may apparently induce free iron in the liver and exert oxidative stress by enhancing reactive oxygen species production and block normal postneonatal liver metabolism. PMID: 28503569 Data suggest that elevated serum levels of soluble TNF receptors, especially sTNFR1, are associated with loss of kidney function in Hispanic patients with diabetes type 2 in Colombia. PMID: 27068267 Case Report: heterozygous missense variants in TNFRSF1A identified in family members with familial Mediterranean fever. PMID: 29148404 Case Report: autoinflammatory syndrome with relapsing aseptic neutrophilic meningitis and chronic myelitis associated with MEFV/TNFRSF1A mutations. PMID: 28134085 In this article we will review the role of ubiquitination and proteolysis in these diverse events focusing on our own contributions to the lysosomal apoptotic pathway linked to the subcellular compartmentalization of TNF-R1 PMID: 28765050 Coadministration of either ATROSAB or EHD2-scTNFR2 into the magnocellular nucleus basalis significantly protected cholinergic neurons and their cortical projections against cell death, and reverted the neurodegeneration-associated memory impairment in a passive avoidance paradigm. Simultaneous blocking of TNFR1 and TNFR2 signaling, however, abrogated the therapeutic effect PMID: 27791020 Data show that interleukin-2 receptor alpha, tumor necrosis factor receptor 1, serum STimulation-2 (IL1RL1 gene product), and regenerating islet-derived 3-alpha were significantly associated with non-relapse mortality. PMID: 28126963 Report of a severe case of TRAPS associated with a novel mutation, Thr90Pro, in the TNFRSF1A gene in an infant and several family members. PMID: 28427379 atopic dermatits patients had increased TNFR1 expression on immune cells PMID: 29212072 Elevated level of soluble tumor necrosis factor receptors 1 and lower level of leptin are associated with higher developmental outcomes in infants between the ages of 6 and 24 months. PMID: 28238825 The highest levels of TNFR1 are independently associated with progression of renal disease and death in type 2 diabetic nephropathy. PMID: 27003829 High plasma levels of TNFR1 and TNFR2 were associated with incident intracerebral hemorrhage. PMID: 28830973 Renal clear cell carcinoma cells cells express increased amounts of RIPK1 and RIPK3 and are poised to undergo necroptosis in response to TNFR1 signaling. PMID: 27362805 TRIM28 acts as a central factor in controlling endothelial inflammatory responses and angiogenic activities by retaining expression of TNFR-1 and -2 and VEGF receptor 2 in endothelial cells PMID: 28159803 a specific link between the penetrance of the TNFRSF1A mutation and the observed T cell phenotype, is reported. PMID: 26598380 Collectively, this study provides more insights into RELT expression, RELT family member function, and the mechanism of RELT-induced death. PMID: 28688764 Burkholderia cenocepacia BcaA binds to tumor necrosis factor receptor 1. PMID: 27684048 TNFRSF1A variants were identified in 10 tumor necrosis factor receptor-associated periodic syndrome patients from 10 independent families. The T61I variant was found in patients, while the V136M and S321I variants were found in 1 patient each. All the patients were heterozygous for the variants. Among the healthy controls, 7 of 363 individuals were heterozygous for the T61I variant. PMID: 27332769 Voxel-based morphometry was used to analyse the associations between TNFRSF1A (rs4149576 and rs4149577) and grey matter structure. Highly significant genotypic associations with striatal volume but not the hippocampus were seen. Specifically, for rs4149576, G homozygotes were associated with reduced caudate nucleus volumes relative to A homozygotes and heterozygotes. Reduced caudate volumes were observed in C homozygotes PMID: 27528091 Circulating TNFR1 and 2 were shown to be associated with cardiovascular disease, independent of age, sex, inflammatory markers, and other cardiovascular disease risk factors, in the chronic kidney disease patients PMID: 28489742 Infection with C. trachomatis disturbs TNFR1 signalling specifically at the level of receptor internalization. PMID: 27062399 Data suggest that TRAF2 (TNF receptor-associated factor 2) negatively regulates (1) TNFR1- (tumor necrosis factor binding protein 1)-induced apoptosis, (2) TNFR2- (tumor necrosis factor receptor type 2)-induced non-canonical NFkappaB signaling, and (3) TNF- (tumor necrosis factor)-induced necroptosis. [REVIEW] PMID: 26993379 Our analysis showed that the TNFR1 rs2234649 polymorphism does not increase ankylosing spondylitis risk. In conclusion, the TNFR1 gene polymorphism tested does not appear to be useful for assessing predisposition to ankylosing spondylitis. PMID: 28363009 elevated serum level associated with heart failure risk in type 2 diabetes mellitus patients PMID: 28367848 The data demonstrate a novel and unexpected function of BIG1 that regulates TNFR1 signaling by targeting TRAF2. PMID: 27834853 Data indicate that plasma concentrations of TNFR1 and TNFR2 are elevated in pediatric lupus nephritis. PMID: 26854079 TNFR1 is the major pro-inflammatory mediator of TNF-alpha in fibroblast-like synoviocytes (FLS), whereas TNFR2, may act as an immunosuppressor in FLS for the prevention of overwhelming inflammatory reactions. PMID: 28150360 Results suggest that miR-29a is an important regulator of tumor necrosis factor receptor 1 expression in breast cancer and functions as a tumor suppressor by targeting tumor necrosis factor receptor 1 to influence the growth of MCF-7 cell. PMID: 28222663 Serum sTNFR1 and sTNFR2 are associated with obese girls but not obese boys, thereby suggesting that serum sTNFRs in early childhood obesity may be sex related. PMID: 27040725 SCCAg, CYFRA 21.1, IL-6, VEGF and sTNF receptors have roles in squamous cell cervical cancer PMID: 26289850

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1A (TNFRSF1A) Protein (His), Active

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 1A (TNFRSF1A) Protein (His), Active

Product Overview

Target Details

FAQs