Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01937P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-01937P
Collections: Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Recombinant cell therapy targets for car-t research, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q02223 |
Target Symbol | TNFRSF17 |
Synonyms | B-cell maturation protein |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
Expression Range | 1-54aa |
Protein Length | Partial |
Mol. Weight | 10.9 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. |
Subcellular Location | Cell membrane; Single-pass type III membrane protein. Endomembrane system; Single-pass type III membrane protein. Note=Perinuclear Golgi-like structures. |
Database References | |
Associated Diseases | A chromosomal aberration involving TNFRSF17 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with IL2. |
Tissue Specificity | Expressed in mature B-cells, but not in T-cells or monocytes. |
Gene Functions References
- Expression patterns of BAFF and its receptor BCMA differ according to lupus nephritis class. PMID: 29087261
- High BCMA expression is associated with primary central nervous system lymphoma. PMID: 28521029
- soluble BCMA sequesters circulating BAFF, thereby preventing it from performing its signaling to stimulate normal B-cell and plasma cell development, resulting in reduced polyclonal antibody levels in multiple myeloma patients. PMID: 26960399
- Studied expression of B-cell maturation antigen (BCMA) in osteoblasts and the toxic effect of chromium on its expression; found BCMA is involved in osteogenesis of osteoblasts; chromium downregulates expression of BCMA in osteoblasts. PMID: 26011700
- BCMA has other contributors for ligands binding except DxL motif. The affinity of BCMA for APRIL higher than for BAFF may be caused by the segment outside of the conservative DxL motif. Moreover, the exposition of new binding modes of BCMA2 interacting with APRIL may establish the foundation of designing novel drugs in the future PMID: 28260502
- New molecular mechanisms of in vivo Multiple Myeloma (MM) growth and immunosuppression critically dependent on BCMA and APRIL in the Bone marrow microenvironment, further supporting targeting this prominent pathway in MM. PMID: 27127303
- We have identified a specific serum protein, BCMA, as a novel independent marker for both monitoring and predicting outcomes for MM patients. We have shown that sBCMA is elevated in MM patients, and can be used to follow their disease status, PFS and OS. PMID: 28034989
- The expression levels of serum BAFF and the three receptors (TACI, BCMA and BAFF-R) in non-Hodgkin lymphoma patients were significantly higher than in healthy controls. PMID: 28028945
- Decreased BCMA expression on peripheral B cells according to severe disease activity suggests that BCMA plays an important regulating role in B-cell hyperactivity and immune tolerance homeostasis in systemic lupus erythematosus patients PMID: 26424128
- results suggest that Akt and JNK pathways are involved in the regulation of B-cell maturation antigen (BCMA) PMID: 26914861
- shedding of BCMA by gamma-secretase controls plasma cells in the bone marrow and yields a potential biomarker for B-cell involvement in human autoimmune diseases PMID: 26065893
- elevated serum levels in patients with Behcet's disease PMID: 25759827
- Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies. PMID: 25301447
- High BCMA expression is associated with breast cancer. PMID: 25750171
- BAFF and APRIL as well as their cognate receptors (BCMA, TACI) correlate with glioma grade. (Meta-analysis) PMID: 24376672
- The B cell maturation antigen (BCMA) is a tumor necrosis family receptor member that is predominantly expressed on terminally differentiated B cells and, upon binding to its ligands B cell activator of the TNF family and a proliferation inducing ligand. PMID: 23237506
- Activation of B cells through BCMA regulates spinal cord injury-induced autoimmunity via a proliferation-inducing ligand (APRIL) and B-cell-activating factor (BAFF). PMID: 23088438
- Data indicate that MAGE3, Survivin and B-cell maturation antigen (BCMA) mRNA-pulsed dendritic cells (DCs) are capable of stimulating tumor-associated antigens (TAA)-specific T-cell responses in multiple myeloma (MM) patients. PMID: 23728352
- Data indicate that B-cell maturation antigen (BCMA) is a suitable target for chimeric antigen receptor (CAR)-expressing T cells, and adoptive transfer of anti-BCMA-CAR-expressing T cells is a promising new strategy for treating multiple myeloma. PMID: 23344265
- B-cell maturation antigen (BCMA), an essential membrane protein for maintaining the survival of plasma cells, was identified as a glycoprotein exhibiting complex-type N-glycans at a single N-glycosylation site, asparagine 42. PMID: 23776238
- the effect of APRIL is mediated via BCMA, which does not activate the classical NF-kappaB pathway, whereas it induces a novel signaling pathway, which involves JNK2 phosphorylation, FOXO3A activation, and GADD45 transcription PMID: 23071284
- Serum BCMA levels were higher among patients with progressive disease than those with responsive disease. Overall survival was shorter among patients whose serum BCMA levels were above the median. PMID: 22804669
- TNFRSF17 may be a candidate gene associated with the pathogenesis of colon cancer. PMID: 22108903
- These data advance BCMA as an inflammation-related TNF superfamily member in keratinocytes, of potential importance in the management of inflammatory skin conditions. PMID: 22166983
- primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI PMID: 21687682
- This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma. PMID: 21483105
- Signaling through BCMA enhances B cell activation following exposure to TLR9 agonists, and increased expression in SLE may contribute to the production of IgG autoantibodies. PMID: 21250838
- genetic polymorphisms are associated with gastrointestinal disorders PMID: 20016944
- Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival. PMID: 14512299
- APRIL.TACI_d2 and APRIL.BCMA complexes together reveal the mechanism by which TACI engages high affinity ligand binding through a single cysteine-rich domain PMID: 15542592
- BCMA is a target of donor B-cell immunity in patients with myeloma who respond to Donor lymphocyte infusions PMID: 15692072
- Review. APRIL interactions with BCMA likely govern memory B cell populations. PMID: 16919470
- Review. Direct BAFF/APRIL signalling in T cells and/or T cell modulation in response to a BAFF-modified B cell compartment may play an important role in inflammation and immunomodulation. PMID: 16931039
- The BCMA inhibited HRS cell accumulation in vitro and might attenuate HL expansion in vivo. PMID: 16960154
- BCMA TVs were observed only in some CD19+ cell samples. PMID: 17825416
- rheumatoid arthritis fibroblast like synoviocytes are stimulated by APRIL and express the APRIL receptor BCMA PMID: 17968879
- Expression of B cell maturation Ag (BCMA) is also highly regulated and we demonstrate that BCMA expression is only acquired in MB cells and in a manner accompanied by loss of BAFF-R expression. PMID: 18025170
- we observed APRIL expression, together with TACI and BCMA in gut-associated lymphoid tissue, lamina propria, and in the epithelium of stomach, small and large intestine, and rectum. PMID: 19741596