Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (hFc), Active
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (hFc), Active
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Recombinant cell therapy targets for car-t research, Tumor necrosis factors and receptors (tnfs)
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 10 μg/ml can bind human BCMA, the EC 50 of human BCMA protein is 221.3-298.6 ng/ml. 3. Human TNFSF13B protein Fc tag captured on COOH chip can bind Human BCMA protein Fc tag with an affinity constant of 39 nM as detected by LSPR Assay. 4. Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 μg/ml can bind Biotinylated human TNFSF13B , the EC 50 is 0.1752-0.3657 ng/ml. |
| Uniprotkb | Q02223 |
| Target Symbol | TNFRSF17 |
| Synonyms | B cell maturation antigen; B cell maturation factor; B cell maturation protein; B-cell maturation protein; BCM; BCMA; CD269; CD269 antigen; TNFRSF17; TNR17_HUMAN; Tumor necrosis factor receptor superfamily member 17 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Target Protein Sequence | MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
| Expression Range | 1-54aa |
| Protein Length | Partial |
| Mol. Weight | 34.8 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity. Activates NF-kappa-B and JNK. |
| Subcellular Location | Cell membrane; Single-pass type III membrane protein. Endomembrane system; Single-pass type III membrane protein. Note=Perinuclear Golgi-like structures. |
| Database References | HGNC: 11913 OMIM: 109545 KEGG: hsa:608 STRING: 9606.ENSP00000053243 UniGene: PMID: 29087261 |
