Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active
Brand: Beta LifeScience
SKU: BLC-05837P
Price: 240.0 USD
Availability: InStock

Greater than 95% as determined by SDS-PAGE.

Activity Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC 50 is 9.943-15.72 ng/ml. Biological Activity Assay

Activity Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B , the EC 50 is 0.2699-0.5613 ng/ml. Biological Activity Assay

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Back to school. back to lab. ready for results. - advance your research with beta lifescience, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Price Save $167

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active is produced by our Mammalian cell expression system. This is a protein fragment.
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/ug as determined by LAL method.
Activity	1. Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC 50 is 9.943-15.72 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B , the EC 50 is 0.2699-0.5613 ng/ml.
Uniprotkb	Q96RJ3
Target Symbol	TNFRSF13C
Synonyms	(B-cell-activating factor receptor)(BAFF receptor)(BAFF-R)(BLyS receptor 3)(CD268)(BAFFR)(BR3)
Species	Homo sapiens (Human)
Expression System	Mammalian cell
Tag	C-hFc-Flag
Target Protein Sequence	SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Expression Range	7-71aa
Protein Length	Partial
Mol. Weight	36.4 kDa
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response.
Subcellular Location	Membrane; Single-pass type III membrane protein.
Database References	HGNC: 17755 OMIM: 606269 KEGG: hsa:115650 STRING: 9606.ENSP00000291232 UniGene: PMID: 27436754 Expression patterns of BAFF and its receptor BAFF-R differ according to lupus nephritis class. PMID: 29087261 up-regulated expression in intractable temporal lobe epilepsy PMID: 28441631 Inhibition of ADAM10 augments BAFF-dependent survival of primary human B cells, whereas inhibition of ADAM17 increases BAFFR expression levels. PMID: 28249164 Relationships between serum BAFF and BBR expression [(BAFFR, calcium signal modulating cyclophilic ligand interactor (TACI) and B cell maturation antigen (BCMA)] were determined on B cell subsets, defined using immunoglobulin (Ig)D/CD38. Twenty pre-RTX and 18 rheumatoid arthritis patients relapsing after B cell depletion were included. PMID: 28800164 Among the BAFF receptors in a cohort of rheumatoid arthritis (RA) patients, the AA have shown, by fluorescence activated cell sorter (FACS) analysis of median fluorescence intensity (MFI), that transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI) and B cell maturation antigen (BCMA) do not change PMID: 28834574 The expression levels of serum BAFF and the three receptors (TACI, BCMA and BAFF-R) in non-Hodgkin lymphoma patients were significantly higher than in healthy controls. PMID: 28028945 Variants in BAFF-R gene is associated with chronic lymphocytic leukemia. PMID: 27468724 BAFF-R, as the principal receptor of BAFF, not only decreased the apoptosis of B cells and CD8+ T cells by upregulating the expression of Bcl-2 and BclxL, but also promoted B-cell proliferation in immune thrombocytopenia. PMID: 26749059 genetic polymorphism contributes to the pathogenesis of primary antibody deficiency PMID: 26613719 BAFF and BAFF-R are expressed in the thyrocytes derived from patients with either autoimmune thyroid disorders or multinodular goiter, as well in the infiltrating immune cells of Graves' disease and Hashimoto's thyroiditis PMID: 26214745 There is an increased prevalence of the BAFF-R His159Tyr mutation in patients with Sjogren's syndrome (SS), particularly in those with SS complicated by MALT lymphoma whose disease onset occurred at a younger age. PMID: 26097183 Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells. PMID: 25569260 Variants of TNFRSF13C were associated with common variable immunodeficiency. PMID: 26122175 Negative expression of BAFF-R, but not of BAFF, could be an independent risk factor for progression-free survival and Overall survival in patients with diffuse large B-cell lymphoma treated with standard R-CHOP. PMID: 26327569 the common TLR4-D299G, TLR4-T399I and BAFFR-P21R polymorphisms provide the carriers with a protective advantage against ICU-acquired sepsis; this finding was more profound for medical patients compared to trauma or surgical ones PMID: 25454804 Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies. PMID: 25301447 In view of the restricted expression of the BAFF-R on normal cells and the multiple anti-pre-B ALL activities stimulated by this antibody, a further examination of its use for treatment of pre-B ALL is warranted. PMID: 24825858 Availability of BAFF determines BAFF-R and TACI expression on B cells in common variable immunodeficiency. PMID: 24809296 Our study demonstrates that BR3 is involved in the survival of cultured epithelial cells due to an autocrine effect of BAFF. PMID: 24602383 BAFF-R, but not BAFF, may have a role in progression-free survival and overall survival in follicular lymphoma PMID: 23272079 BLyS and its receptors are expressed by B lymphocytes in the peripheral blood and the bone marrow of patients with multiple myeloma. PMID: 23276925 P21R/H159Y TNFRSF13C compound heterozygous mutation and P21R heterozygous mutations were detected in Turkish patients with common variable immunodeficiency. PMID: 22699762 BAFF-R expression is tightly regulated during B-cell development in mouse and human and this exprssion is correlated with posirive selection. PMID: 22028296 It was also found that NF-kappaB was an important transcription factor involved in regulating BAFF-R expression through one NF-kappaB binding site in the BAFF-R promoter PMID: 21607696 Soluble BAFF levels inversely correlate with peripheral B cell numbers and the expression of BAFF receptors. PMID: 22124120 The activation profile of diffuse large B-cell lymphomas/posttransplantation lymphoproliferative disorders was not associated with BAFF/BAFF-R expression, whereas nuclear p52 activation might be linked to Epstein-Barr virus. PMID: 21871426 The human BAFF-R gene might be regulated via a transcriptional event through one putative NF-kappaB site on the BAFF-R gene promoter. PMID: 21744373 reduced expression via inhibition of the NF-KappaB pathway in B cells of rheumatoid arthritis patients PMID: 21515993 primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI PMID: 21687682 This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma. PMID: 21483105 BLyS and its receptors might have a potential role in the growth and survival of malignant plasma cells. PMID: 19731825 Results describe the mechanisms underlying aberrant BAFF-R expression in precursor B acute lymphoblastic leukemia (precursor B-ALL) and mature B chronic lymphocytic leukemia (CLL). PMID: 21099364 BAFF-R was rather specifically related to low growth activity of germinal center B-cell-like -type diffuse large B-cell lymphoma of nodal origin. PMID: 21123970 inverse correlation between BAFF and APRIL in Kawasaki disease is reversed by IVIG treatment PMID: 20945608 Elevated plasma BAFF and reduced BAFF receptor 3 (BR3) protein expression on peripheral B cells could act as biomarkers for active disease in systemic lupus erythematosus patients PMID: 20974656 a novel lymphoma-associated mutation in human BAFF-R that results in NF-kappaB activation and reveals TRAF6 as a necessary component of normal BAFF-R signaling. PMID: 21041452 Data from BAFF-R-expressing cells suggested potential regulatory sites in TNFRSF13C promoter region. PMID: 20554963 This report is the first showing universal expression of BAFF-R by pre-B ALL cells. PMID: 20460528 IFN-gamma and the NF-kappaB pathway could be involved in regulating the transcription and mRNA expression of BAFF-R gene. PMID: 20230666 the mechanism of transcriptional regulation of BAFF-R PMID: 20025535 BAFF-R is a receptor for the TNF family member ligand, BAFF [review] PMID: 12456020 BAFFR-mediated NF-kappa B activation and IL-10 production in B cells is downregulated by TNFR-associated factor-3. PMID: 12471121 crystal structure and interaction with BAFF protein PMID: 12715002 BAFF/BLyS receptor 3 comprises a minimal TNF receptor-like module that encodes a highly focused ligand-binding site. PMID: 12755599 Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival. PMID: 14512299 This study reports the crystal structure of a 24-residue fragment of the cytoplasmic portion of BAFF-R bound in complex with TRAF3. PMID: 15585864 the PVPAT sequence of BAFFR not only functions as a key signaling motif of BAFFR but also determines its signaling specificity in the induction of the noncanonical NF-kappaB pathway PMID: 15644327 amino acid sequence of genomic DNA from blood of common variable immunodeficiency patients;mutations may result in humoral immunodeficiency PMID: 16160919 BAFF-R is expressed on most mature B cells and B-cell lymphoproliferative disorders. PMID: 16226112

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active

Product Overview

Target Details

FAQs