Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Christmas & new year research sale — 30% off storewide, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC 50 is 9.943-15.72 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B , the EC 50 is 0.2699-0.5613 ng/ml. |
| Uniprotkb | Q96RJ3 |
| Target Symbol | TNFRSF13C |
| Synonyms | (B-cell-activating factor receptor)(BAFF receptor)(BAFF-R)(BLyS receptor 3)(CD268)(BAFFR)(BR3) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc-Flag |
| Target Protein Sequence | SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA |
| Expression Range | 7-71aa |
| Protein Length | Partial |
| Mol. Weight | 36.4 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. |
| Subcellular Location | Membrane; Single-pass type III membrane protein. |
| Database References | HGNC: 17755 OMIM: 606269 KEGG: hsa:115650 STRING: 9606.ENSP00000291232 UniGene: PMID: 27436754 |
