Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active
Beta LifeScience
SKU/CAT #: BLC-05837P
Greater than 95% as determined by SDS-PAGE.
Activity Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC 50 is 9.943-15.72 ng/ml. Biological Activity Assay
Activity Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B , the EC 50 is 0.2699-0.5613 ng/ml. Biological Activity Assay
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active
Beta LifeScience
SKU/CAT #: BLC-05837P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 13C (TNFRSF13C) Protein (hFc-Flag), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | 1. Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B at 2 μg/ml can bind TNFRSF13C, the EC 50 is 9.943-15.72 ng/ml. 2. Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B , the EC 50 is 0.2699-0.5613 ng/ml. |
Uniprotkb | Q96RJ3 |
Target Symbol | TNFRSF13C |
Synonyms | (B-cell-activating factor receptor)(BAFF receptor)(BAFF-R)(BLyS receptor 3)(CD268)(BAFFR)(BR3) |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc-Flag |
Target Protein Sequence | SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA |
Expression Range | 7-71aa |
Protein Length | Partial |
Mol. Weight | 36.4 kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. |
Subcellular Location | Membrane; Single-pass type III membrane protein. |
Database References | |
Associated Diseases | Immunodeficiency, common variable, 4 (CVID4) |
Tissue Specificity | Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes. |
Gene Functions References
- the B-cell receptor BR3 modulates cellular branching via Rac1 during neuronal migration PMID: 27436754
- Expression patterns of BAFF and its receptor BAFF-R differ according to lupus nephritis class. PMID: 29087261
- up-regulated expression in intractable temporal lobe epilepsy PMID: 28441631
- Inhibition of ADAM10 augments BAFF-dependent survival of primary human B cells, whereas inhibition of ADAM17 increases BAFFR expression levels. PMID: 28249164
- Relationships between serum BAFF and BBR expression [(BAFFR, calcium signal modulating cyclophilic ligand interactor (TACI) and B cell maturation antigen (BCMA)] were determined on B cell subsets, defined using immunoglobulin (Ig)D/CD38. Twenty pre-RTX and 18 rheumatoid arthritis patients relapsing after B cell depletion were included. PMID: 28800164
- Among the BAFF receptors in a cohort of rheumatoid arthritis (RA) patients, the AA have shown, by fluorescence activated cell sorter (FACS) analysis of median fluorescence intensity (MFI), that transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI) and B cell maturation antigen (BCMA) do not change PMID: 28834574
- The expression levels of serum BAFF and the three receptors (TACI, BCMA and BAFF-R) in non-Hodgkin lymphoma patients were significantly higher than in healthy controls. PMID: 28028945
- Variants in BAFF-R gene is associated with chronic lymphocytic leukemia. PMID: 27468724
- BAFF-R, as the principal receptor of BAFF, not only decreased the apoptosis of B cells and CD8+ T cells by upregulating the expression of Bcl-2 and BclxL, but also promoted B-cell proliferation in immune thrombocytopenia. PMID: 26749059
- genetic polymorphism contributes to the pathogenesis of primary antibody deficiency PMID: 26613719
- BAFF and BAFF-R are expressed in the thyrocytes derived from patients with either autoimmune thyroid disorders or multinodular goiter, as well in the infiltrating immune cells of Graves' disease and Hashimoto's thyroiditis PMID: 26214745
- There is an increased prevalence of the BAFF-R His159Tyr mutation in patients with Sjogren's syndrome (SS), particularly in those with SS complicated by MALT lymphoma whose disease onset occurred at a younger age. PMID: 26097183
- Expression of mutant caspase-9 correlated with a downregulation of BAFFR (B-cell-activating factor belonging to the TNF family (BAFF) receptor) in B cells and ICOS (inducible T-cell costimulator) in T cells. PMID: 25569260
- Variants of TNFRSF13C were associated with common variable immunodeficiency. PMID: 26122175
- Negative expression of BAFF-R, but not of BAFF, could be an independent risk factor for progression-free survival and Overall survival in patients with diffuse large B-cell lymphoma treated with standard R-CHOP. PMID: 26327569
- the common TLR4-D299G, TLR4-T399I and BAFFR-P21R polymorphisms provide the carriers with a protective advantage against ICU-acquired sepsis; this finding was more profound for medical patients compared to trauma or surgical ones PMID: 25454804
- Data show significant differences in expression of tumour necrosis factor family (BAFF) receptors BAFF-R, BCMA and TACI in patients with and without anti-Jo-1 or anti-Ro52/anti-Ro60 autoantibodies. PMID: 25301447
- In view of the restricted expression of the BAFF-R on normal cells and the multiple anti-pre-B ALL activities stimulated by this antibody, a further examination of its use for treatment of pre-B ALL is warranted. PMID: 24825858
- Availability of BAFF determines BAFF-R and TACI expression on B cells in common variable immunodeficiency. PMID: 24809296
- Our study demonstrates that BR3 is involved in the survival of cultured epithelial cells due to an autocrine effect of BAFF. PMID: 24602383
- BAFF-R, but not BAFF, may have a role in progression-free survival and overall survival in follicular lymphoma PMID: 23272079
- BLyS and its receptors are expressed by B lymphocytes in the peripheral blood and the bone marrow of patients with multiple myeloma. PMID: 23276925
- P21R/H159Y TNFRSF13C compound heterozygous mutation and P21R heterozygous mutations were detected in Turkish patients with common variable immunodeficiency. PMID: 22699762
- BAFF-R expression is tightly regulated during B-cell development in mouse and human and this exprssion is correlated with posirive selection. PMID: 22028296
- It was also found that NF-kappaB was an important transcription factor involved in regulating BAFF-R expression through one NF-kappaB binding site in the BAFF-R promoter PMID: 21607696
- Soluble BAFF levels inversely correlate with peripheral B cell numbers and the expression of BAFF receptors. PMID: 22124120
- The activation profile of diffuse large B-cell lymphomas/posttransplantation lymphoproliferative disorders was not associated with BAFF/BAFF-R expression, whereas nuclear p52 activation might be linked to Epstein-Barr virus. PMID: 21871426
- The human BAFF-R gene might be regulated via a transcriptional event through one putative NF-kappaB site on the BAFF-R gene promoter. PMID: 21744373
- reduced expression via inhibition of the NF-KappaB pathway in B cells of rheumatoid arthritis patients PMID: 21515993
- primary leukemia B-cell precursors aberrantly express receptors of the BAFF-system, BAFF-R, BCMA, and TACI PMID: 21687682
- This is the first study, presenting together the TNFSF members APRIL, BAFF, TWEAK and their receptors in different areas of normal renal tissue and renal cell carcinoma. PMID: 21483105
- BLyS and its receptors might have a potential role in the growth and survival of malignant plasma cells. PMID: 19731825
- Results describe the mechanisms underlying aberrant BAFF-R expression in precursor B acute lymphoblastic leukemia (precursor B-ALL) and mature B chronic lymphocytic leukemia (CLL). PMID: 21099364
- BAFF-R was rather specifically related to low growth activity of germinal center B-cell-like -type diffuse large B-cell lymphoma of nodal origin. PMID: 21123970
- inverse correlation between BAFF and APRIL in Kawasaki disease is reversed by IVIG treatment PMID: 20945608
- Elevated plasma BAFF and reduced BAFF receptor 3 (BR3) protein expression on peripheral B cells could act as biomarkers for active disease in systemic lupus erythematosus patients PMID: 20974656
- a novel lymphoma-associated mutation in human BAFF-R that results in NF-kappaB activation and reveals TRAF6 as a necessary component of normal BAFF-R signaling. PMID: 21041452
- Data from BAFF-R-expressing cells suggested potential regulatory sites in TNFRSF13C promoter region. PMID: 20554963
- This report is the first showing universal expression of BAFF-R by pre-B ALL cells. PMID: 20460528
- IFN-gamma and the NF-kappaB pathway could be involved in regulating the transcription and mRNA expression of BAFF-R gene. PMID: 20230666
- the mechanism of transcriptional regulation of BAFF-R PMID: 20025535
- BAFF-R is a receptor for the TNF family member ligand, BAFF [review] PMID: 12456020
- BAFFR-mediated NF-kappa B activation and IL-10 production in B cells is downregulated by TNFR-associated factor-3. PMID: 12471121
- crystal structure and interaction with BAFF protein PMID: 12715002
- BAFF/BLyS receptor 3 comprises a minimal TNF receptor-like module that encodes a highly focused ligand-binding site. PMID: 12755599
- Expression of BCMA, TACI, and BAFF-R by multiple myeloma cells support cell growth and survival. PMID: 14512299
- This study reports the crystal structure of a 24-residue fragment of the cytoplasmic portion of BAFF-R bound in complex with TRAF3. PMID: 15585864
- the PVPAT sequence of BAFFR not only functions as a key signaling motif of BAFFR but also determines its signaling specificity in the induction of the noncanonical NF-kappaB pathway PMID: 15644327
- amino acid sequence of genomic DNA from blood of common variable immunodeficiency patients;mutations may result in humoral immunodeficiency PMID: 16160919
- BAFF-R is expressed on most mature B cells and B-cell lymphoproliferative disorders. PMID: 16226112