Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 11B (TNFRSF11B) Protein (hFc-Flag), Active
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 11B (TNFRSF11B) Protein (hFc-Flag), Active
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Celebrate thanksgiving with 30% off all beta lifescience products!, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 11B (TNFRSF11B) Protein (hFc-Flag), Active is produced by our Mammalian cell expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 ) at 10 μg/ml can bind human TNFRSF11B, the EC 50 is 2.651-7.646 ng/ml. |
| Uniprotkb | O00300 |
| Target Symbol | TNFRSF11B |
| Synonyms | (Osteoclastogenesis inhibitory factor)(Osteoprotegerin)(OCIF)(OPG) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc-Flag |
| Target Protein Sequence | ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL |
| Expression Range | 22-401aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 73.5 kDa |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis. |
| Subcellular Location | Secreted. |
| Database References |
HGNC: 11909 OMIM: 239000 KEGG: hsa:4982 STRING: 9606.ENSP00000297350 UniGene: PMID: 28867452 |

