Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D (TNFRSF10D) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00525P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D (TNFRSF10D) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-00525P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D (TNFRSF10D) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q9UBN6 |
Target Symbol | TNFRSF10D |
Synonyms | (Decoy receptor 2)(DcR2)(TNF-related apoptosis-inducing ligand receptor 4)(TRAIL receptor 4)(TRAIL-R4)(TRAIL receptor with a truncated death domain)(CD antigen CD264) |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | C-6His |
Target Protein Sequence | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH |
Expression Range | 56-211aa |
Protein Length | Partial |
Mol. Weight | 18.3 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway. |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database References | |
Tissue Specificity | Widely expressed, in particular in fetal kidney, lung and liver, and in adult testis and liver. Also expressed in peripheral blood leukocytes, colon and small intestine, ovary, prostate, thymus, spleen, pancreas, kidney, lung, placenta and heart. |
Gene Functions References
- The high-dose hook effect was apparent during ELISA testing of uDcR2 in chronic kidney disease (CKD) patients, yet dilution of the urine samples neutralized this effect. However, the use of a four-fold dilution of urine for uDcR2/cre testing may eliminate the high-dose hook effect and make it possible to effectively monitor the severity of TII in CKD patients. PMID: 29879421
- results suggest that CD264 is a surface marker of cellular age for bone marrow-derived mesenchymal stem cells. PMID: 28962588
- Urinary DcR2 could potentially serve as a novel biomarker for tubulointerstitial injury and may reflect senescence of renal proximal tubular cells in diabetic nephropathy. PMID: 28356293
- Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases. PMID: 26542757
- membrane expression more common in endometrioid endometrial cancer than in normal endometrium PMID: 24649804
- This study identified TNFRSF10D DNA methylation status as an independent prognostic biomarker for relapse-free survival and overall mortality in non-metastatic melanoma patients. PMID: 25003639
- The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival. PMID: 23584885
- the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis. PMID: 24211571
- TRAIL receptor-4 expression profiles on T cells might be important in revelation of rheumatoid arthritis pathogenesis. PMID: 20799941
- ANT2 shRNA treatment sensitized MCF7, T47 D, and BT474 cells to TRAIL-induced apoptosis by up-regulating the expression of TRAIL death receptors 4 and 5 (DR4 and DR5) and down-regulating the TRAIL decoy receptor 2 (DcR2). PMID: 20875141
- these results demonstrated that hypoxia-inducible factor 1alpha played a crucial role in regulating the transcription of DcR2. PMID: 20018172
- Enhanced expression of DcR2 promotes peripheral blood eosinophil survival in the airways of allergic asthmatics following segmental antigen challenge. PMID: 12421985
- Cytotoxicity and apoptosis induced by TRAIL to beta-cell lines CM were inhibited competitively by soluble TRAIL receptors, R1, R2, R3 or R4. PMID: 12488957
- Respiratory syncytial virus infection strongly up-regulated the expression of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and its functional receptors death receptor 4 (DR4) and DR5. PMID: 12915532
- Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. PMID: 14999791
- The DcR2 was found to have a truncated and non-functional death domain. PMID: 15538968
- CD8+ lymphocytes and NKT lymphocytes, but not CD4+ lymphocytes, express TRAIL-R4 PMID: 15919363
- Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R4. PMID: 15921376
- Preligand assembly domain-mediated ligand-independent association between TRAIL receptor 4 (TR4) and TR2 regulates TRAIL-induced apoptosis. PMID: 16319225
- DCR2 was found positive in 81 and 33% normal, 46 and 10% nodular hyperplasia, 74 and 36% PIN tissues, 87 and 89% low-grade carcinomas, and 100 and 93% high-grade carcinomas PMID: 16799475
- TRAIL-R4-beta is a new splice variant of TRAIL-receptor 4 lacking the cysteine rich domain 1 PMID: 16934748
- The specificity of DcR1- and DcR2-mediated TRAIL inhibition reveals an additional level of complexity for the regulation of TRAIL signaling. PMID: 16980609
- CASP8, DCR2, and HIN-1 methylation leads to progression of neuroblastoma PMID: 17545522
- These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors. PMID: 18460741
- DCR2-methylated patients showed significantly poorer 5-year event-free survival in the whole neuroblastoma group (43% PMID: 18980997
- High TRAIL death receptor 4 and decoy receptor 2 expression correlates with significant cell death in pancreatic ductal adenocarcinoma patients. PMID: 18981952
- Results indicate that disc cells, after herniation, undergo apoptotic cell death via the DR5/TRAIL pathway. PMID: 19730199