Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D (TNFRSF10D) Protein (His)

Name: Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D (TNFRSF10D) Protein (His)
Brand: Beta LifeScience
SKU: BLC-00525P
Price: 240.0 USD
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Back to school. back to lab. ready for results. - advance your research with beta lifescience, Buy cytokines, chemokines, and growth factors for research online, High-quality cytokines for advanced research, High-quality recombinant proteins, In-stock recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Price Save $419

Size

100ug

Quantity

Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10D (TNFRSF10D) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9UBN6
Target Symbol	TNFRSF10D
Synonyms	(Decoy receptor 2)(DcR2)(TNF-related apoptosis-inducing ligand receptor 4)(TRAIL receptor 4)(TRAIL-R4)(TRAIL receptor with a truncated death domain)(CD antigen CD264)
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	C-6His
Target Protein Sequence	ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Expression Range	56-211aa
Protein Length	Partial
Mol. Weight	18.3 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to PubMed:9382840, it cannot but according to PubMed:9430226, it can induce the NF-kappa-B pathway.
Subcellular Location	Membrane; Single-pass type I membrane protein.
Database References	HGNC: 11907 OMIM: 603614 KEGG: hsa:8793 STRING: 9606.ENSP00000310263 UniGene: PMID: 29879421 results suggest that CD264 is a surface marker of cellular age for bone marrow-derived mesenchymal stem cells. PMID: 28962588 Urinary DcR2 could potentially serve as a novel biomarker for tubulointerstitial injury and may reflect senescence of renal proximal tubular cells in diabetic nephropathy. PMID: 28356293 Results identified epigenetic inactivation of TNFRSF10C and TNFRSF10D in majority of cervical cancer cases. PMID: 26542757 membrane expression more common in endometrioid endometrial cancer than in normal endometrium PMID: 24649804 This study identified TNFRSF10D DNA methylation status as an independent prognostic biomarker for relapse-free survival and overall mortality in non-metastatic melanoma patients. PMID: 25003639 The membrane expression of the TRAIL receptors DR4, DR5, DcR1 and DcR2 is greater in normal endometrium than endometrioid adenocarcinoma (EAC). The level of the receptors in EAC is not dependent on grading and staging and does not predict survival. PMID: 23584885 the results presented here claim for a relevant impact of aberrant methylation of decoy receptors in melanoma and allow to understand how the silencing of DcR1 and DcR2 is related to melanomagenesis. PMID: 24211571 TRAIL receptor-4 expression profiles on T cells might be important in revelation of rheumatoid arthritis pathogenesis. PMID: 20799941 ANT2 shRNA treatment sensitized MCF7, T47 D, and BT474 cells to TRAIL-induced apoptosis by up-regulating the expression of TRAIL death receptors 4 and 5 (DR4 and DR5) and down-regulating the TRAIL decoy receptor 2 (DcR2). PMID: 20875141 these results demonstrated that hypoxia-inducible factor 1alpha played a crucial role in regulating the transcription of DcR2. PMID: 20018172 Enhanced expression of DcR2 promotes peripheral blood eosinophil survival in the airways of allergic asthmatics following segmental antigen challenge. PMID: 12421985 Cytotoxicity and apoptosis induced by TRAIL to beta-cell lines CM were inhibited competitively by soluble TRAIL receptors, R1, R2, R3 or R4. PMID: 12488957 Respiratory syncytial virus infection strongly up-regulated the expression of tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) and its functional receptors death receptor 4 (DR4) and DR5. PMID: 12915532 Our results demonstrate that DcR1 and DcR2 genes are frequently methylated in various tumor types and aberrant methylation was the cause for silencing of DcR1 and DcR2 expression. PMID: 14999791 The DcR2 was found to have a truncated and non-functional death domain. PMID: 15538968 CD8+ lymphocytes and NKT lymphocytes, but not CD4+ lymphocytes, express TRAIL-R4 PMID: 15919363 Resistance to TRAIL-induced apoptosis in acute myeloid leukemia cells is associated with expression of TRAIL-R4. PMID: 15921376 Preligand assembly domain-mediated ligand-independent association between TRAIL receptor 4 (TR4) and TR2 regulates TRAIL-induced apoptosis. PMID: 16319225 DCR2 was found positive in 81 and 33% normal, 46 and 10% nodular hyperplasia, 74 and 36% PIN tissues, 87 and 89% low-grade carcinomas, and 100 and 93% high-grade carcinomas PMID: 16799475 TRAIL-R4-beta is a new splice variant of TRAIL-receptor 4 lacking the cysteine rich domain 1 PMID: 16934748 The specificity of DcR1- and DcR2-mediated TRAIL inhibition reveals an additional level of complexity for the regulation of TRAIL signaling. PMID: 16980609 CASP8, DCR2, and HIN-1 methylation leads to progression of neuroblastoma PMID: 17545522 These data strongly support a recent proposal that a segment at 8p21.3 contains crucial prostate cancer tumor suppressors. PMID: 18460741 DCR2-methylated patients showed significantly poorer 5-year event-free survival in the whole neuroblastoma group (43% PMID: 18980997 High TRAIL death receptor 4 and decoy receptor 2 expression correlates with significant cell death in pancreatic ductal adenocarcinoma patients. PMID: 18981952 Results indicate that disc cells, after herniation, undergo apoptotic cell death via the DR5/TRAIL pathway. PMID: 19730199

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.