Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-06023P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-06023P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Protein (His), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is less than 200 ng/ml. |
| Uniprotkb | O14798 |
| Target Symbol | TNFRSF10C |
| Synonyms | TNFRSF10C; DCR1; LIT; TRAILR3; TRID; UNQ321/PRO366; Tumor necrosis factor receptor superfamily member 10C; Antagonist decoy receptor for TRAIL/Apo-2L; Decoy TRAIL receptor without death domain; Decoy receptor 1; DcR1; Lymphocyte inhibitor of TRAIL; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; TRAIL receptor without an intracellular domain; CD antigen CD263 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-6His |
| Complete Sequence | ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA |
| Expression Range | 26-221aa |
| Protein Length | Partial |
| Mol. Weight | 21.78 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2 |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand. |
| Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
| Database References | HGNC: 11906 OMIM: 603613 KEGG: hsa:8794 STRING: 9606.ENSP00000349324 UniGene: PMID: 28420351 |
