Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 9 (TNFSF9) Protein (hFc-Myc), Active
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 9 (TNFSF9) Protein (hFc-Myc), Active
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Christmas & new year research sale — 30% off storewide, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, In-stock recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Submit an inquiry or email sales for a custom bulk quote. Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Connect with us via the live chat in the bottom corner to receive immediate assistance.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 9 (TNFSF9) Protein (hFc-Myc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 μg/mL can bind TNFRSF9, the EC 50 is 2.671-3.702 ng/mL. |
| Uniprotkb | P41273 |
| Target Symbol | TNFSF9 |
| Synonyms | (4-1BB ligand) (4-1BBL) |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | N-hFc-Myc |
| Target Protein Sequence | REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Expression Range | 71-254aa |
| Protein Length | Partial |
| Mol. Weight | 48.0 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. |
| Subcellular Location | Membrane; Single-pass type II membrane protein. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 11939 OMIM: 606182 KEGG: hsa:8744 STRING: 9606.ENSP00000245817 UniGene: PMID: 27431276 |
