Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 8 (TNFSF8) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05822P
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 8 (TNFSF8) Protein (hFc), Active
Beta LifeScience
SKU/CAT #: BLC-05822P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Cluster of differentiation (cd) proteins, Featured cd protein molecules, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 8 (TNFSF8) Protein (hFc), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L, the EC 50 is 4.169-6.360 ng/ml. |
Uniprotkb | P32971 |
Target Symbol | TNFSF8 |
Synonyms | TNFSF8; CD30L; CD30LG; Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD antigen CD153 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | N-hFc |
Target Protein Sequence | QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Expression Range | 63-234aa |
Protein Length | Partial |
Mol. Weight | 45.8 kDa |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. |
Subcellular Location | Membrane; Single-pass type II membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References | HGNC: 11938 OMIM: 603875 KEGG: hsa:944 STRING: 9606.ENSP00000223795 UniGene: PMID: 24447865 |