Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 6 (FASLG) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09711P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 6 (FASLG) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-09711P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 6 (FASLG) Protein (His) is produced by our Yeast expression system. This is a cytoplasmic protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P48023 |
Target Symbol | FASLG |
Synonyms | ALPS1B; Apoptosis (APO 1) antigen ligand 1; Apoptosis antigen ligand 1; Apoptosis antigen ligand; APT1LG1; APTL; CD178; CD178 antigen; CD95 ligand; CD95-L; CD95L; CD95L protein; Fas antigen ligand; Fas L; Fas ligand (TNF superfamily member 6); Fas ligand; FASL; Fasl Fas ligand (TNF superfamily member 6); FASLG; Generalized lymphoproliferative disease; Gld; soluble form; TNFL6_HUMAN; TNFSF6; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor ligand superfamily member 6 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | QIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Expression Range | 130-281aa |
Protein Length | Cytoplasmic Domain |
Mol. Weight | 19.3kDa |
Research Area | Apoptosis |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death (AICD) in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis.; Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways. Can induce apoptosis but does not appear to be essential for this process.; Cytoplasmic form induces gene transcription inhibition. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein. Cytoplasmic vesicle lumen. Lysosome lumen.; [Tumor necrosis factor ligand superfamily member 6, soluble form]: Secreted.; [FasL intracellular domain]: Nucleus. |
Protein Families | Tumor necrosis factor family |
Database References | HGNC: 11936 OMIM: 134638 KEGG: hsa:356 STRING: 9606.ENSP00000356694 UniGene: PMID: 29611722 |