Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (Fc-Myc)
Beta LifeScience
SKU/CAT #: BLC-06159P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (Fc-Myc)
Beta LifeScience
SKU/CAT #: BLC-06159P
Collections: All products, Buy cytokines, chemokines, and growth factors for research online, Co-stimulatory receptors, Featured immune checkpoint protein molecules, High-quality cytokines for advanced research, High-quality recombinant proteins, Immune checkpoint proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 14 (TNFSF14) Protein (Fc-Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O43557 |
| Target Symbol | TNFSF14 |
| Synonyms | TNFSF14; HVEML; LIGHT; UNQ391/PRO726; Tumor necrosis factor ligand superfamily member 14; Herpes virus entry mediator ligand; HVEM-L; Herpesvirus entry mediator ligand; CD antigen CD258 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-FC-Myc |
| Target Protein Sequence | DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Expression Range | 74-240aa |
| Protein Length | Partial |
| Mol. Weight | 48.3 |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production. |
| Subcellular Location | [Tumor necrosis factor ligand superfamily member 14, membrane form]: Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 14, soluble form]: Secreted.; [Isoform 2]: Cytoplasm. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 11930 OMIM: 604520 KEGG: hsa:8740 STRING: 9606.ENSP00000469049 UniGene: PMID: 29359470 |
