Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO)

Name: Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09972P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, High-quality cytokines for advanced research, High-quality recombinant proteins, Tumor necrosis factors and receptors (tnfs)

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9Y275
Target Symbol	TNFSF13B
Synonyms	ApoL related ligand TALL 1; B cell Activating Factor; B lymphocyte stimulator; B-cell-activating factor; BAFF; BLyS; CD 257; CD257; CD257 antigen; Delta BAFF; Dendritic cell derived TNF like molecule; Dendritic cell-derived TNF-like molecule; DTL; DTL precursor; PRO738; soluble form; TALL 1; TALL-1; TALL1; THANK; TN13B_HUMAN; TNF and APOL related leukocyte expressed ligand 1; TNF homolog that activates apoptosis ; TNF homolog that activates apoptosis NKFB and JNK.; TNF- and APOL-related leukocyte expressed ligand 1; TNFSF13B; TNFSF20; TNLG7A; Tumor necrosis factor (ligand) superfamily member 13b; Tumor necrosis factor ligand 7A; Tumor necrosis factor ligand superfamily member 13b; Tumor necrosis factor ligand superfamily member 20; Tumor necrosis factor like protein ZTNF4; Tumor necrosis factor superfamily member 13B; UNQ401; ZTNF4
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
Expression Range	68-285aa
Protein Length	Extracellular Domain
Mol. Weight	39.7kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.; Isoform 2 seems to inhibit isoform 1 secretion and bioactivity.; Acts as a transcription factor for its own parent gene, in association with NF-kappa-B p50 subunit, at least in autoimmune and proliferative B-cell diseases. The presence of Delta4BAFF is essential for soluble BAFF release by IFNG/IFN-gamma-stimulated monocytes and for B-cell survival. It can directly or indirectly regulate the differential expression of a large number of genes involved in the innate immune response and the regulation of apoptosis.
Subcellular Location	Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 13b, soluble form]: Secreted.
Protein Families	Tumor necrosis factor family
Database References	HGNC: 11929 OMIM: 603969 KEGG: hsa:10673 STRING: 9606.ENSP00000365048 UniGene: PMID: 29572442 analysis of how BAFF is neutralized by belimumab gives insight into treatment of systemic lupus erythematosus PMID: 29572471 Study uncovers a previously unrecognized regulation of BAFF by testosterone and raises important questions about BAFF in testosterone-mediated protection against autoimmunity. Among healthy men, serum BAFF levels are higher in men with low testosterone. PMID: 29802242 High BAFF expression is associated with systemic lupus erythematosus. PMID: 28992184 Co-immunoprecipitation analysis and siRNA-mediated suppression of CREB expression indicated that phospho-CREB has a positive effect on pro-inflammatory gene expression in the crosstalk between BAFF- and TLR4-mediated signaling by forming trimeric complexes containing NF-kappaB, CBP, and CREB PMID: 28374824 this study shows that BAFF augments IgA2 and IL-10 production by TLR7/8 stimulated total peripheral blood B cells PMID: 28921509 elevated pretransplant serum BAFF levels negatively affect renal allograft survival and represent a risk factor for allosensitization and subsequent antibody-mediated rejection PMID: 29277566 Increased BAFF expression is associated with B cell class switching in patients with tuberculous pleural effusion. PMID: 29845274 Expression patterns of BAFF and its receptors differ according to lupus nephritis class. PMID: 29087261 Serum BAFF levels are elevated in idiopathic inflammatory myositis, more so in children. PMID: 29516280 Post-transplant antibody mediated rejection in kidney transplantation recipients can be predicted by perioperative elevations in serum BAFF level. PMID: 27888573 The results of the present study revealed a correlation between BAFF and the PI3K/Akt/mTOR signaling pathway, and it is hypothesized that they are involved in the pathogenesis of lupus nephritis PMID: 28849060 The results suggest that increased levels of BAFF and APRIL produced in the central nervous system may influence the development of anti-neutrophil cytoplasmic antibody-hypertrophic pachymeningitis. PMID: 28847534 Blood B lymphocyte stimulator (BLyS)/BAFF levels of HIV-uninfected commercial sex workers (CSWs) were lower than those observed in both HIV-infected CSW and HIV-uninfected non-CSW groups. PMID: 27561453 our study throws light on the crosstalk between BAFF and BCR signaling pathways in neoplastic B cells, and provides insights into the mechanistic effects of SYK inhibitors in CLL. PMID: 28838991 genetic polymorphisms of BAFF may increase the risk of posttransplant development of donor specific antibodies in kidney allograft recipients PMID: 28624489 P\pre-sensitized patients had significantly higher BAFF levels before transplantation and suffered significantly more often from early steroid-resistant, mainly antibody-mediated rejections PMID: 28867309 Elevated blood BAFF levels could be associated with a more stable disease. PMID: 27383531 BAFF rs9514828 polymorphism may be associated with the chronic hepatitis and the combinatorial action of rs9514828 and rs12583006 may confer susceptibility to chronic HBV infection and the resolution of the infection, suggesting that host genetic factors associated with B cell mediated immune responses are involved in chronic HBV infection. PMID: 28627389 This study demonstrated that An Increase of Cerebrospinal Fluid B-cell Activating Factor Level in Pediatric Patients With Acute Viral Encephalitis. PMID: 28259511 data show that BAFF levels at the time of cGvHD diagnosis are associated with non-relapse-mortality, and also are potentially useful for risk stratification. PMID: 28481353 BAFF-R was consistently expressed on B cells infected by HCMV. Enhancement of BAFF/BAFF-R signaling decreased the apoptosis rate and extended the survival of B cells. PMID: 28442365 soluble BCMA sequesters circulating BAFF, thereby preventing it from performing its signaling to stimulate normal B-cell and plasma cell development, resulting in reduced polyclonal antibody levels in multiple myeloma patients. PMID: 26960399 up-regulated expression in intractable temporal lobe epilepsy PMID: 28441631 results showed that serum BAFF in nasal type, extranodal NK/T cell lymphoma patients was significantly higher than that in control group and negatively correlated with patients' survival. PMID: 27668971 BAFF has a role in inducing IL35 production by regulatory B cells in lupus PMID: 28844943 Inhibition of ADAM10 augments BAFF-dependent survival of primary human B cells, whereas inhibition of ADAM17 increases BAFFR expression levels PMID: 28249164 Data presented show that B-cell activating factor (BAFF) plays a central role in the induction and maintenance of cigarette smoke-induced pulmonary antinuclear antibodies and suggest a therapeutic potential for BAFF blockade in limiting autoimmune processes associated with smoking. PMID: 28039405 Among the BAFF receptors in a cohort of rheumatoid arthritis (RA) patients, the AA have shown, by fluorescence activated cell sorter (FACS) analysis of median fluorescence intensity (MFI), that transmembrane activator and calcium-modulating cyclophilin ligand interactor (TACI) and B cell maturation antigen (BCMA) do not change PMID: 28834574 The BAFF promoter increased in response to TNF-alpha treatment or overexpression of HIF-1alpha. However, TNF-alpha-induced BAFF expression and promoter activity decreased after treatment with the ERK inhibitor PD98059. PMID: 28383556 This study indicates that orbital fibroblasts from Graves' orbitopathy can express BAFF and mediate the intraorbital survival of B cells via BAFF mechanism. PMID: 28087387 Rapamycin attenuates excessive hsBAFF-induced cell proliferation/survival via blocking mTORC1/2 signaling in normal and neoplastic B-lymphoid cells. PMID: 28300280 Inhibition of B cell plasmablast differentiation by reduction of Aiolos and Ikaros may have utility in the treatment of systemic lupus erythematosus , where elevated levels of BAFF and Aiolos may prime CD27(+) memory and double negative memory-like B cells to become Ab-producing plasmablasts in the presence of BAFF and proinflammatory cytokines. PMID: 28848067 BCMA has other contributors for ligands binding except DxL motif. The affinity of BCMA for APRIL higher than for BAFF may be caused by the segment outside of the conservative DxL motif. Moreover, the exposition of new binding modes of BCMA2 interacting with APRIL may establish the foundation of designing novel drugs in the future PMID: 28260502 study demonstrated a high prevalence of endogenous antibodies to BAFF in a multi-ethnic Asian systemic lupus erythematosus (SLE) cohort; while levels of serum BAFF correlated positively with disease activity, levels of anti-BAFF antibody were correlated negatively with levels of its target cytokine, anti-dsDNA antibody and clinical disease activity PMID: 28388832 this study provides new useful information about the increased levels of BAFF observed during HIV-1 infection and highlights the importance of macrophages as a source of BAFF PMID: 27022194 The novel association between BAFF and inflammatory bowel disease (IBD) seems to identify that BAFF might regulate the inflammatory process in these diseases and it appears to be a potential marker of IBD. PMID: 27056038 In BAFF, rs2893321 may be a susceptible genetic variant for the development of GD and AITDs. Associations of rs2893321 with susceptibility to GD and AITDs and the correlation between rs2893321 and TAb exhibit a dimorphic pattern. Additional studies with larger sample sizes are required to confirm our findings. PMID: 27136204 BAFF and IL-17A are associated with different subphenotypes of primary Sjogren's syndrome. PMID: 25941062 The expression levels of serum BAFF and the three receptors (TACI, BCMA and BAFF-R) in non-Hodgkin lymphoma patients were significantly higher than in healthy controls. PMID: 28028945 Plasma BAFF levels were positively associated with serum creatinine, proteinuria, uric acid and group A Streptococcus infection index in patients with IgA nephropathy. PMID: 28260100 this study shows that chicoric acid suppresses BAFF expression by inhibiting NF-kappaB activity, and chicoric acid may serve as a novel therapeutic agent to down-regulate excessive BAFF expression in autoimmune diseases PMID: 28122293 Findings indicate that BAFF expression is significantly increased in chronic rhinosinusitis with nasal polyps patients and may orchestrate inflammatory load in polyp tissues by regulating T and B cell-mediated response. PMID: 28035475 Urinary APRIL (uAPRIL) and BAFF (uBAFF) levels were raised significantly in AN. PMID: 27804111 BAFF levels are lower in patients with antibody-mediated kidney rejection and also in patients with concurrent humoral and cellular rejection compared with patients without rejection PMID: 28083608 The BLyS level is increased in some lupus patients. There was a moderate correlation with titers of anti-DNA antibody and disease activity. PMID: 27100979 In Sjogren's syndrome (SS) patients, EULAR Sjogren's syndrome disease activity index (ESSDAI) is negatively associated with serum levels of 25(OH)-D3 and positively associated with BAFF. PMID: 28074193 These results suggest that miR-202 functions as a modulator that can negatively regulate BAFF by inhibiting multiple myeloma tumor cell survival, growth, and adhesion in the bone marrow microenvironment. PMID: 25971527 Variants in BAFF gene is associated with chronic lymphocytic leukemia. PMID: 27468724 The results demonstrated that BAFF has an important role in the pathogenesis of newly diagnosed childhood immune thrombocytopenia. PMID: 24911453

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO)

Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 13B Protein (TNFSF13B) Protein (His-SUMO)

Product Overview

Target Details

FAQs