Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 12 (TNFSF12) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09125P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 12 (TNFSF12) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09125P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 12 (TNFSF12) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | O43508 |
Target Symbol | TNFSF12 |
Synonyms | APO 3 ligand; APO 3L; APO3 ligand; APO3/DR3 ligand; APO3L; DR3LG; MGC129581; MGC20669; secreted form; TNF-related weak inducer of apoptosis; TNF12_HUMAN; TNFSF 12; Tnfsf12; TNFSF12 protein; Tumor necrosis factor (ligand) superfamily member 12; Tumor necrosis factor ligand superfamily member 12; Tumor necrosis factor superfamily member 12; TWEAK; UNQ181/PRO207 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His-SUMO |
Target Protein Sequence | SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Expression Range | 43-249aa |
Protein Length | Extracellular Domain |
Mol. Weight | 38.9 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion. |
Subcellular Location | Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein. |
Protein Families | Tumor necrosis factor family |
Database References | HGNC: 11927 OMIM: 602695 KEGG: hsa:407977 UniGene: PMID: 19913121 |