Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 11 (TNFSF11) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-06031P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 11 (TNFSF11) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-06031P
Collections: All products, Antibody / cell therapy targets, Antibody therapeutic / adc target proteins, Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins, Tumor necrosis factors and receptors (tnfs)
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Tumor Necrosis Factor Ligand Superfamily Member 11 (TNFSF11) Protein (His), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to binding SF11A used funtional ELISA is less than 10 ug/ml. |
| Uniprotkb | O14788 |
| Target Symbol | TNFSF11 |
| Synonyms | TNFSF11; OPGL; RANKL; TRANCE; Tumor necrosis factor ligand superfamily member 11; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; Receptor activator of nuclear factor kappa-B ligand; TNF-related activation-induced cytokine; CD antigen CD254 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Complete Sequence | IRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Expression Range | 140-317aa |
| Protein Length | Partial |
| Mol. Weight | 22.4 kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation. |
| Subcellular Location | [Isoform 1]: Cell membrane; Single-pass type II membrane protein.; [Isoform 3]: Cell membrane; Single-pass type II membrane protein.; [Isoform 2]: Cytoplasm.; [Tumor necrosis factor ligand superfamily member 11, soluble form]: Secreted. |
| Protein Families | Tumor necrosis factor family |
| Database References | HGNC: 11926 OMIM: 259710 KEGG: hsa:8600 STRING: 9606.ENSP00000239849 UniGene: PMID: 29241686 |
