Recombinant Human Tubulinyl-Tyr Carboxypeptidase 1 (VASH1) Protein (His)

Name: Recombinant Human Tubulinyl-Tyr Carboxypeptidase 1 (VASH1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04259P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Tubulinyl-Tyr Carboxypeptidase 1 (VASH1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q7L8A9
Target Symbol	VASH1
Synonyms	KIAA1036; VASH; VASH1; VASH1_HUMAN; Vasohibin 1; Vasohibin-1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Expression Range	1-204aa
Protein Length	Full Length of Isoform 2
Mol. Weight	27.3 kDa
Research Area	Cardiovascular
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function. Critical for spindle function and accurate chromosome segregation during mitosis since microtuble detyronisation regulates mitotic spindle length and postioning. Acts as an angiogenesis inhibitor: inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts.
Subcellular Location	Cytoplasm. Secreted.
Protein Families	Vasohibin family
Database References	HGNC: 19964 OMIM: 609011 KEGG: hsa:22846 STRING: 9606.ENSP00000167106 UniGene: PMID: 28656230 VASH1 is a prognostic marker in ovarian carcinoma. PMID: 29057763 VASH1 and VASH2 but not SVBP alone, increased detyrosination of -tubulin, and purified vasohibins removed the C-terminal tyrosine of -tubulin. PMID: 29146869 High serum prolactin and vasoinhibin levels predict and may impact retinopathy of prematurity progression PMID: 27842054 Studied angiogenic activity of vasohibin-1 (VASH1), by analyzing levels of VASH1 in both RCC tissue and non-neoplastic kidney tissue. Found elevated VASH1 density, but not microvascular density, was a significant and independent predictor of overall survival in RCC. PMID: 28287633 identified a novel UPS regulatory system in which essential domain architecture (VASH-PS) of VASHs, comprising regions VASH191-180 and VASH280-169 , regulate the cytosolic punctate structure formation in the absence of SVBP. PMID: 27879017 replicative senescence, the downregulation of VASH1 expression in endothelial cells was caused, at least in part, by the alteration of microRNA expression. PMID: 27325558 VASH1 expression is associated with tumour progression and may be useful as a prognostic marker of head and neck squamous cell carcinoma PMID: 28314285 VASH1 expression inhibited tumor vascularization and growth, not only in high VEGF-producing cells, but also in high PDGF-producing cells, reduced their peritoneal dissemination and ascites, and prolonged the survival time of the host PMID: 26893100 in this study, the length of tube forming structures of endothelial cells in vitro showed that Vasohibin-1 expression in gastric cancer cells significantly decreased the ability of vessel formation of endothelium cells. PMID: 26666821 These results indicate that cancer cells proteolytically inactivate VASH1 protein secreted by ECs in the tumour microenvironment PMID: 27169581 Our present findings on VASH1A and VASH1B should provide an innovative approach that would improve the efficacy of antiangiogenic cancer therapy by balancing vascular normalization and pruning. PMID: 27080222 VASH1 exerts an antitumor effect on ovarian cancer by inhibiting angiogenesis in the tumor environment PMID: 26460696 VASH1 expression levels in atheroma reflects both enhanced neovascularization and the inflammatory burden PMID: 25843115 Knockdown of VASH1 in cancer cells promoted cell growth, adhesion and migration in vitro, and enhanced tumorigenesis and metastasis in vivo. PMID: 25797264 VASH1 and VASH2 showed distinctive localization and opposing function on the fetoplacental vascularization. PMID: 25184477 These results suggest that the renal levels of VASH-1 may be affected by local inflammation, crescentic lesions and VEGFR-2. PMID: 25145408 High VASH1 expression is associated with non-small cell lung cancer. PMID: 24748406 Overexpression of VASH1 in CRC cells increased malignant potential and promoted metastasis. PMID: 25275025 We found that vasohibin-1 and VEGF are up-regulated, in mesentery and liver, in cirrhotic and precirrhotic portal hypertensive rats and cirrhosis patients. PMID: 24390792 High Vasohibin-1 expression is associated with colorectal cancer. PMID: 24366689 Vasohibin 1/CD34 could identify the proliferative vessels and could be a useful biomarker for predicting the clinical outcome of hepatocellular carcinoma patients. PMID: 24444468 Data show expression of TGF-beta1, TGF-beta2, BMP-4, and BMP-7 was increased in tumor-associated macrophages (TAMs) cocultured with pancreatic cancer cells, and vasohibin-1, VEGF-A, and vVEGF-C expression in pancreatic cancer cells was upregulated by TAMs. PMID: 23651239 Vasohibin-1 is a new predictor of disease-free survival in operated patients with renal cell carcinoma. PMID: 23543668 Vasohibin-1 and VEGF-A are the most important factors influencing the dismal prognosis based on the modulation of angiogenesis in hepatocellular carcinoma (HCC). PMID: 22101788 vasohibin-1 and vasohibin-2 mRNA are expressed in gastric cancer cells and in tumor-associated macrophages (TAMs), and their expressions are altered by hypoxia. PMID: 22438034 VASH1 density represents a clinically relevant predictor of patient prognosis and can be a new biomarker that would provide additional prognostic information in prostate cancer. PMID: 23591203 we postulate that VASH1 would potentially be a biomarker and a candidate for molecular targeted therapy for patients with renal cell carcinoma PMID: 22865127 novel candidate master regulator of endothelial cell apoptosis PMID: 23324451 VASH1 is a critical factor that improves the stress tolerance of ECs via the induction of SOD2 and SIRT1 PMID: 23056314 Data suggest that VASH1 is expressed in vascular endothelium to terminate angiogenesis; VASH2 appears to be expressed in other cells (primarily mononuclear leukocytes) to promote angiogenesis. [REVIEW] PMID: 23100270 Results suggest that Vasohibin-1 (VASH1)density could become a new biomarker and provide additional prognostic information in patients with upper urinary tract urothelial carcinomas (UTUC). PMID: 22675166 Transgene expression of VASH1 in the recipient lung significantly attenuated luminal obliteration of the tracheal allograft and significantly reduced aberrant angiogenesis. PMID: 22564651 Data suggest that vasohibin inhibits cell proliferation of umbilical vein endothelial cells through degradation of HIF-1alpha via proline hydroxylase during oxidative stress. Vasohibin may be a negative feedback regulator of angiogenesis. PMID: 22569265 Reduced vasohibin and VEGF expression may be responsible, at least in part, for the impaired vascular development which occurs during pre-eclampsia. PMID: 21302448 SVBP(CCDC23)acts as a secretory chaperone for VASH1. PMID: 20736312 vasohibin1 is the first known intrinsic factor having broad-spectrum antilymphangiogenic activity PMID: 20133819 This review focuses on negative regulators of angiogenesis delta-like 4 and vasohibin 1 produced by endothelial cells. PMID: 20167561 These results suggest that vasohibin-1 is expressed in RA synovial tissue and might be regulated by inflammatory cytokines. PMID: 20035291 Results suggest that KIAA1036, or vasohibin, is an endothelium-derived negative feedback regulator of angiogenesis [vasohibin] PMID: 15467828 Recombinant amino-terminal truncated forms of vasohibin retain inhibitory activity of angiogenesis in mouse corneal assay and show strong affinity to heparin. PMID: 16488400 vasohibin has an activity to prevent neointimal formation by inhibiting adventitial angiogenesis PMID: 16707096 expression of vasohibin in the stromal endothelial cells in human carcinomas. PMID: 18325046 vasohibin-1 is associated with neovascularization and may especially play important roles in the regulation of intratumoral angiogenesis in human breast cancer. PMID: 19037993 Hypoxia induces VEGF, which induces the production of vasohibin-1 in endothelial cells and inhibits angiogenesis as a negative feedback regulator. PMID: 19057892 These results suggest a role for VASH1 in negative feedback regulation of haematopoietic progenitors proliferation during recovery following bone marrow ablation. PMID: 19179360 These results suggest that endogenous vasohibin-1 is involved in tumor angiogenesis and exogenous vasohibin-1 blocks sprouting angiogenesis by tumors, matures the remaining vessels, and enhances the antitumor effect of conventional chemotherapy PMID: 19498005 Streptozotocin- induced type 1 diabetic mice received intravenous injections of adenoviral vectors encoding VASH-1, which suppressed diabetic retinopathy. PMID: 19587360 Overexpression of human VASH1 inhibited angiogenic sprouting and supports vascular maturation processes in vivo. PMID: 19682397

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Tubulinyl-Tyr Carboxypeptidase 1 (VASH1) Protein (His)

Recombinant Human Tubulinyl-Tyr Carboxypeptidase 1 (VASH1) Protein (His)

Product Overview

Target Details

FAQs