Recombinant Human Trypsin-2 (PRSS2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-07591P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Trypsin-2 (PRSS2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-07591P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Trypsin-2 (PRSS2) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P07478 |
Target Symbol | PRSS2 |
Synonyms | (Anionic trypsinogen)(Serine protease 2)(Trypsin II) |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS |
Expression Range | 16-247aa(K23Q,S167G) |
Protein Length | Partial |
Mol. Weight | 52.4 kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | In the ileum, may be involved in defensin processing, including DEFA5. |
Subcellular Location | Secreted, extracellular space. |
Protein Families | Peptidase S1 family |
Database References | |
Tissue Specificity | Expressed in Paneth cells, at the base of small intestinal crypts. |
Gene Functions References
- evaluated the association of claudin2 and PRSS1-PRSS2 polymorphisms with idiopathic recurrent acute (RAP) and chronic pancreatitis PMID: 26110235
- PRSS2 single nucleotide polymorphism associated with the development of alcoholic pancreatitis. PMID: 25253127
- Serum trypsinogen-2 is associated with pancreatic cancer and pancreatitis. PMID: 25916077
- trypsin-2 over-expression enhanced tongue carcinoma cell invasion by various genetic and proteolytic mechanisms. PMID: 22909050
- Elevation of urine trypsinogen 2 is an independent risk factor for pancreatic fistula after pancreaticoduodenectomy. PMID: 22357509
- Report a simple, rapid, easy, and noninvasive urinary trypsinogen-2 test can diagnose or rule out most cases of acute pancreatitis. PMID: 22481290
- Data show that urinary trypsinogen-2 dipstick test is a useful test for early diagnosis of post-endoscopic retrograde cholangiopancreatography (ERCP) pancreatitis. PMID: 21946810
- results suggest that trypsinogen-2 is a more sensitive marker than amylase, and it can be useful in early diagnosis of post-endoscopic retrograde cholangiopancreatography (ERCP) pancreatitis. PMID: 21792081
- A genetic variant of PRSS2 may contribute to the low prevalence of pancreatitis in primary hyperparathyroidism patients. PMID: 20625975
- Hyperexpression of the PRSS2 gene is associated with pancreatic cancer. PMID: 20428826
- there was a borderline statistically significant association between pancreatic cancer and HAT/HCT but no association between pancreatic cancer and HAT, HCT. PMID: 20484960
- Urine trypsinogen-2 test may be an important diagnostic tool in excluding the diagnosis of acute pancreatitis; it has a negative predictive value. PMID: 20517765
- Results do not support the urinary trypsinogen-2 dipstick test (UTDT) to replace standard plasma amylase for the diagnosis of AP, however, the test demonstrated an adequate sensitivity to be used for rapid early screening of AP in daily clinics. PMID: 19752771
- Results indicate that up-regulation of anionic trypsinogen in pancreatic diseases does not affect physiological trypsinogen activation, but significantly limits trypsin generation under potential pathological conditions. PMID: 12709065
- High levels of pulmonary trypsin-2 may be associated with the development of bronchopulmonary dysplasia in preterm infants. PMID: 12949286
- G191R variant of PRSS2 mitigates intrapancreatic trypsin activity and thereby protects against chronic pancreatitis PMID: 16699518
- Our results suggest that serum trypsinogen-2 is a most useful marker for diagnosing patients with cholangiocarcinoma, and it is superior to serum CA19-9 and CEA. PMID: 17640760
- Co-localization of trypsin-2 and MMP-9 resulted in intracellular proMMP-9 processing that represented fully or partially activated MMP-9. PMID: 18062964
- A loss of function polymorphism (G191R) of anionic trypsinogen (PRSS2) confers protection against chronic pancreatitis. PMID: 18362849
- A fusion with PRSS1 is associated with hereditary pancreatitis. PMID: 18461367
- primary role of trypsinogen sulfation in humans is to stimulate autoactivation of PRSS1 PMID: 18986305
- The p.G191R variant protected against alcoholic and idiopathic chronic pancreatitis as well as alcoholic acute pancreatitis in Japan. PMID: 19052022
- G191R PRSS2 is a rare allele in the Indian population and the data suggest a nonsignificant trend towards a protective effect from tropical calcific pancreatitis in Indians. PMID: 19077465