Recombinant Human Trefoil Factor 3 (TFF3) Protein (His)

Name: Recombinant Human Trefoil Factor 3 (TFF3) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04187P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: Buy cytokines, chemokines, and growth factors for research online, Growth factors and receptors for advanced research, High-quality cytokines for advanced research, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Trefoil Factor 3 (TFF3) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q07654
Target Symbol	TFF3
Synonyms	hITF; hP1.B; Intestinal trefoil factor; ITF; mITF; OTTMUSP00000021729; P1B; Polypeptide P1.B; TFF3; TFF3_HUMAN; TFI; TREFOIL; Trefoil factor (intestinal); Trefoil factor 3
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Expression Range	29-80aa
Protein Length	Partial
Mol. Weight	7.5 kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Subcellular Location	Secreted, extracellular space, extracellular matrix. Cytoplasm.
Database References	HGNC: 11757 OMIM: 600633 KEGG: hsa:7033 STRING: 9606.ENSP00000430690 UniGene: PMID: 29987860 Authors hypothesised that TFF3 may involve regulatory networks of ncRNAs to exert its effects as a scattering factor. PMID: 28277538 The highly specific expression of TFF3 in mucinous ovarian cancer may help to further clarify potential relationships of tumors with mucinous histology PMID: 28470574 This is, to our knowledge, the first report of decreased expression of TFF3, SPDEF, KLF4, and goblet cell population in the colon of patients with HSCR. Altered goblet cell function may result in intestinal barrier dysfunction contributing to the development of HAEC. PMID: 29383490 High TFF3 expression is associated with oncogenicity and chemoresistance in hepatocellular carcinoma. PMID: 28445151 Results indicate diagnostic biomarker potential of Trefoil factor 3 (TFF3) promoter hypomethylation for prostate cancer (PC) as well as prognostic biomarker potential of TFF3 RNA expression. PMID: 28930171 ITF role in promoting intestinal epithelial cells migration through crosstalk between the ERK and JAK/STAT3 pathways PMID: 27616044 TFF3 levels were significantly elevated in patients with stage I (p= 0.001) and T1 gastric cancer (p= 0.013). PMID: 28453457 The present study demonstrated a negative association between the expression of miR75p and TFF3 in IBD lesional tissues and normal tissues. In conclusion, TFF3 was identified as a novel target of miR75p PMID: 28627600 trefoil factors family 3 may have a role in colorectal cancer PMID: 28405143 This study provides the first evidence that TFF3 is locally elevated in the peritoneal cavity in endometriosis and might play a role in disease pathogenesis and its associated inflammatory processes. Furthermore, the results show that TFF3 is regulated through the menstrual cycle. PMID: 27330011 involvement of TFF3 in the pathogenesis of rhonchopathy and OSA PMID: 29028798 Giardia co-infection promotes the secretion of antimicrobial peptides beta-defensin 2 and trefoil factor 3 and attenuates attaching and effacing bacteria-induced intestinal disease.( PMID: 28622393 expression reduces growth, viability, and tumorigenicity of retinoblastoma cell oines PMID: 27626280 The expression of TFF3 and TWIST1 might be associated with the survival of patients with colorectal cancer (CRC) after curative resection and might be pivotal predictors of disease progression. TFF3 may be correlated to the invasiveness of CRC. PMID: 28104986 Serum TFF-3 is not a convenient and reliable surrogate marker of mucosal healing during therapy with TNF-alpha antagonists in Crohn's disease. PMID: 28104989 TFF3 levels differed among idiopathic pulmonary fibrosis, pulmonary sarcoidosis and chronic pulmonary obstructive disease. PMID: 27758987 TFF3 protein knockout can facilitate apoptosis of human pituitary adenoma HP75 cells via mitochondrial pathway PMID: 26823779 Data show that trefoil factor-3 (TFF3) secreted from mammary carcinoma cells promotes de novo angiogenesis via interleukin-8 (IL-8)/IL-8 receptor CXCR2. PMID: 26559818 Dimers CXCR4 and CXCR7 are involved in TFF3-dependent activation of cell migration, but not cell proliferation. The ERK1/2 pathway is activated in the process, but not influenced by CXCR4 or CXCR7. PMID: 26780310 TFF3 expression is associated with response to endocrine therapy, and outperforms oestrogen receptor, progesterone receptor and TFF1 as an independent biomarker, possibly because it mediates the malign effects of oestrogen on invasion and metastasis PMID: 25900183 the results provide a mechanistic explanation for ITF-mediated protection of gastric epithelial mucosa cells, suggesting that activation of the ERK1/2 signaling pathway may provide a new therapeutic strategy for repairing gastric injury. PMID: 25776570 primary outcome measures were to evaluate the safety, acceptability, and accuracy of the Cytosponge-TFF3 test compared with endoscopy and biopsy. In all, 1,042 (93.9%) patients successfully swallowed the Cytosponge, and there were no serious side effects PMID: 25634542 TFF3 is not only a useful biomarker for a long-term surgical result in CRC patient, but also may be a risk factor of early recurrence. PMID: 25405728 Associations discovered between trefoil factor 3 gene variants and idiopathic recurrent spontaneous abortion. PMID: 25444508 TFF3 expression predicts metastasis and poor survival outcome of patients with mammary carcinoma. PMID: 25266665 TFF3 expression may be absent in the early stages of Barrett's esophagus and its expression may represent more established columnar epithelium. PMID: 25424203 This study suggests that TFF3 is an independent indicator for survival in GC, while HER2 is not associated with the outcome. Patients with HER2-negative/TFF3-negative GC have the best outcome. PMID: 25514872 High TFF3 expression is associated with reduces sensitivity to ionising radiation in prostate carcinoma. PMID: 25748388 Study supports the notion that ITF can promote cell proliferation, migration and preserve epithelium integrity. PMID: 24990304 LRP2 sequencing reveals multiple rare variants associated with urinary trefoil factor-3 PMID: 24876117 Serum concentrations of TFF3 is significantly higher in chronic kidney disease. PMID: 24282531 TFF3 expression at both mRNA and protein levels was significantly downregulated by ErbB-2 silencing in breast cancer cell lines PMID: 24164280 A significantly higher trefoil factor 3 expression in luminal epithelial cells was detected in women with unexplained infertility PMID: 24228773 TFF3 point mutations seem to be a rare event in colorectal carcinogenesis; TFF3 expression may play a role in promoting lymph node metastases of CRCs. PMID: 24125969 TFF3 is an independent indicator for overall survival in gastric cancer. PMID: 23822993 In serum TFFs and pepsinogen tests, only serum TFF3s were not significantly affected by H. pylori eradication, suggesting that serum TFF3 could be a stable biomarker of gastric cancer risk even after H.pylori eradication PMID: 22907485 TFF3 hypermethylation is associated with triple-negative breast cancers. PMID: 24045095 interaction between DMBT1(gp340) and trefoil TFFs proteins was investigated using an ELISA assay. DMBT1(gp340) bound to solid-phase bound recombinant dimeric TFF3 in a calcium dependent manner PMID: 23691218 ER+ /PR+ /TFF3+ /IMP3- immunoprofile distinguishes endometrioid from serous and clear cell carcinomas of the endometrium. PMID: 23570281 Using a Caco-2 cell model the study showed that TLR2 and TFF3 inhibit the IL-1beta induced increase in permeability and release of proinflammatory cytokines, and that this effect is mediated by activation of PI3K/Akt signaling. PMID: 24051092 Distinct ERG and TFF3 protein was expressed in 45% (43/96) and 36% (35/96) of prostate cancers, respectively. PMID: 23856515 Our study suggests that Twist, as an important potential downstream effector, plays a key role in TFF3-modulated metastasis in gastric cancer and can be a promising therapeutic target against intestinal-type gastric cancer. PMID: 23845905 TFF3 activated the epithelial cells in culture to produce beta defensins 2 (hBD2) and beta defensins 4 PMID: 23198942 TFF3 seems to be a novel pathway in the pathogenesis of type I endometrial carcinomas. PMID: 23578537 Upregulation of TFF3 after chemoradiotherapy for rectal cancer is associated with a higher risk of relapse. The physiological role of TFF3 in restoring the mucosa during CRT could be interfering with treatment efficacy. PMID: 22516806 Measurement of TFF3 mRNA in aspirates from thyroid nodules using mesh filtration. PMID: 22572548 TFF3 may contribute to ocular surface wound healing after Amniotic membrane transplantation, but its production by AM is not further inducible by proinflammatory stimuli. PMID: 22476621 Report TFF3 expression in normal/diseased pancreas. PMID: 22286382 Differential expression of MUC5AC involves crosstalk between interleukin-1beta and Akt, whereby the trefoil factor family peptide TFF3 activates Akt by phosphorylation of EGFR. PMID: 22389405

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.