Recombinant Human Transmembrane Protein 119 (TMEM119) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-04995P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Transmembrane Protein 119 (TMEM119) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-04995P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Transmembrane Protein 119 (TMEM119) Protein (hFc) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q4V9L6 |
| Target Symbol | TMEM119 |
| Synonyms | TMEM119; PSEC0199; UNQ731/PRO1415; Transmembrane protein 119; Osteoblast induction factor; OBIF |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-hFc |
| Target Protein Sequence | RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM |
| Expression Range | 26–96aa |
| Protein Length | Partial |
| Mol. Weight | 36.3 kDa |
| Research Area | Others |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Plays an important role in bone formation and normal bone mineralization. Promotes the differentiation of myoblasts into osteoblasts. May induce the commitment and differentiation of myoblasts into osteoblasts through an enhancement of BMP2 production and interaction with the BMP-RUNX2 pathway. Upregulates the expression of ATF4, a transcription factor which plays a central role in osteoblast differentiation. Essential for normal spermatogenesis and late testicular differentiation. |
| Subcellular Location | Cell membrane; Single-pass type I membrane protein. Cytoplasm. Endoplasmic reticulum membrane. |
| Database References | HGNC: 27884 KEGG: hsa:338773 UniGene: PMID: 28496199 |
