Recombinant Human Transmembrane 4 L6 Family Member 1 (TM4SF1) Protein (His)

Name: Recombinant Human Transmembrane 4 L6 Family Member 1 (TM4SF1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-08196P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Transmembrane 4 L6 Family Member 1 (TM4SF1) Protein (His) is produced by our Yeast expression system. This is a extracellular protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P30408
Target Symbol	TM4SF1
Synonyms	M3S1; Membrane component chromosome 3 surface marker 1; T4S1_HUMAN; TAAL6; Tm4sf1; Transmembrane 4 L6 family member 1; Tumor-associated antigen L6
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS
Expression Range	115-161aa
Protein Length	Extracellular Domain
Mol. Weight	7.3kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Subcellular Location	Membrane; Multi-pass membrane protein.
Protein Families	L6 tetraspanin family
Database References	HGNC: 11853 OMIM: 191155 KEGG: hsa:4071 STRING: 9606.ENSP00000304277 UniGene: Hs.351316
Tissue Specificity	Highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular.

Gene Functions References

our study provides a novel regulatory pathway involving TM4SF1, DDR1, MMP2 and MMP9, which promotes the formation and function of invadopodia to support cell migration and invasion in pancreatic cancer. PMID: 28368050
Regulation of transmembrane-4-L-six-family-1 (TM4SF1) on bladder cancer cell could be induced by peroxisome proliferator-activated receptor gamma (PPARgamma)-sirtuin 1 (SIRT1) feedback loop. PMID: 29175458
TM4SF1 was recognized as a direct target for miR-520f in hepatocellular carcinoma (HCC) cells where its expression was found up-regulated and inversely correlated with that of mir-520f. PMID: 29505836
Results suggest that miR-30a is an important regulator of TM4SF1, VEGF, and E-cadherin for CRC lymph node metastasis, a potential new therapeutic target in CRC. PMID: 28528497
High TM4SF1 expression is associated with esophageal cancer. PMID: 27974706
Replacement of the transmembrane 4 L six family protein TM4SF1 or TM4SF4 C-terminus with that of TM4SF5 increased spheroids growth, transwell migration, and invasive dissemination from spheroids in 3D collagen gels. PMID: 28129652
Results indicate that the expression of transmembrane 4 L6 family member 1 (TM4SF1) is higher in pancreatic cancer tissues and pancreatic cancer cell lines than controls. PMID: 27459514
Results show that TM4SF1 expression is elevated in colorectal cancer (CRC), and associated with tumor stage and lymph node metastasis. Also, miR-9 directly targeted its binding site in the TM4SF1 3'-UTR, which has a critical role in regulating CRC cell migration. and invasion. Furthermore, miR-9 regulated cell motility via suppressing PMID: 26983891
The findings suggest that TM4SF1 is a surface membrane antigen that is highly expressed in pancreatic cancer cells and increases the chemoresistance to gemcitabine. TM4SF1 may be a promising target to overcome the chemoresistance of pancreatic cancer. PMID: 26709920
TM4SF1 overexpression significantly contributed MDA-MB-231 cell migration but decreased apoptotic cells PMID: 26464650
Study shows that TM4SF1 expression is associated with better prognosis in pancreatic cancer. Its loss contributes to the invasion and migration of pancreatic cancer cells. PMID: 26035794
We found that miR-203 was significantly downregulated in OSF tissues compared to that in normal buccal mucosa tissues, and that miR-203 negatively regulated secreted SFRP4 and positively regulated TM4SF1 PMID: 25872484
Transmembrane-4-L-six-family-1 is overexpressed in human gliomas in general and the precise level of expression might predict outcome and could be of clinical value. PMID: 25855954
These findings validate TM4SF1 as an attractive candidate for cancer therapy with antibody-bound toxins that have the capacity to react with either cytoplasmic or nuclear targets in tumor cells or tumor-associated vascular endothelium. PMID: 26241677
TM4SF1 is a small plasma membrane glycoprotein that regulates cell motility and proliferation, and possibly a new vascular therapeutic target in cancer PMID: 24986520
High TM4SF1 expression is associated with pancreatic cancer. PMID: 24285464
TM4SF1, like genuine tetraspanins, serves as a molecular organizer that interacts with membrane and cytoskeleton-associated proteins and uniquely initiates the formation of nanopodia and facilitates cell polarization and migration. PMID: 21626280
We provide evidence that ARHGDIA, COBLL1, and TM4SF1 are negative regulators of apoptosis in cultured tumor cells. PMID: 21569526
Inhibition of cell migration after targeted knockdown of TM4SF1 protein expression suggests its contribution to prostate cancer cell metastasis. PMID: 21656834
TM4SF1 can serve as a surface protein marker which singly identifies MSCs from diverse cell sources, in particular, fibroblast-rich connective tissues PMID: 20486778
TAL6 may play a role in cancer invasion and metastasis PMID: 12855661
These data suggest that L6-Ag influences cell motility via TERM by regulating the surface presentation and endocytosis of some of their components. PMID: 18270265
The gene ratio test with the TM4SF1 gene for survival of patients with malignant pleural mesothelioma has robust predictive value. PMID: 19401544

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.