Recombinant Human Transient Receptor Potential Cation Channel Subfamily V Member 1 (TRPV1) Protein (His-GST)

Beta LifeScience SKU/CAT #: BLC-06856P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Transient Receptor Potential Cation Channel Subfamily V Member 1 (TRPV1) Protein (His-GST)

Beta LifeScience SKU/CAT #: BLC-06856P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Transient Receptor Potential Cation Channel Subfamily V Member 1 (TRPV1) Protein (His-GST) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q8NER1
Target Symbol TRPV1
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His-GST
Target Protein Sequence MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETG
Expression Range 1-155aa
Protein Length Partial
Mol. Weight 48.4 kDa
Research Area Neuroscience
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ligand-activated non-selective calcium permeant cation channel involved in detection of noxious chemical and thermal stimuli. Seems to mediate proton influx and may be involved in intracellular acidosis in nociceptive neurons. Involved in mediation of inflammatory pain and hyperalgesia. Sensitized by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases, which involves PKC isozymes and PCL. Activation by vanilloids, like capsaicin, and temperatures higher than 42 degrees Celsius, exhibits a time- and Ca(2+)-dependent outward rectification, followed by a long-lasting refractory state. Mild extracellular acidic pH (6.5) potentiates channel activation by noxious heat and vanilloids, whereas acidic conditions (pH <6) directly activate the channel. Can be activated by endogenous compounds, including 12-hydroperoxytetraenoic acid and bradykinin. Acts as ionotropic endocannabinoid receptor with central neuromodulatory effects. Triggers a form of long-term depression (TRPV1-LTD) mediated by the endocannabinoid anandamine in the hippocampus and nucleus accumbens by affecting AMPA receptors endocytosis.
Subcellular Location Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell projection, dendritic spine membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Protein Families Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV1 sub-subfamily
Database References

HGNC: 12716

OMIM: 602076

KEGG: hsa:7442

STRING: 9606.ENSP00000459962

UniGene: PMID: 29578437

  • C-fibers and transient receptor potential cation channel, subfamily V, member 1 protein (TRPV 1)-mediated vasodilations are impaired in type 1 diabetes (T1D) patients. PMID: 28287157
  • Src kinase mediates UV-induced TRPV1 trafficking into cell membrane in HaCaT keratinocytes. PMID: 29080357
  • Disruption of the association of Sig-1R with TRPV1 by synthetic or natural antagonists leads to degradation of TRPV1 protein and to decreased levels of the ion channel protein as well as to a decrease in TRPV1-associated pain. PMID: 29378958
  • A strong capacity to positively regulate skin sensitization mechanisms related to the TRPV1 receptors. PMID: 29562624
  • Activation of TRPV1 channels attenuates ischemia-reperfusion-induced injury in a variety of organs including heart, kidney, lungs, and brain possibly via enhancing the discharge of calcitonin gene-related peptide and substance P PMID: 28466657
  • cystinosis patients homozygous for the 57-kb deletion exhibit a strong reduction of TRPV1 function, leading to sensory deficiencies akin to the phenotype of TRPV1-deficient mice PMID: 27734949
  • The TRPV1 mRNA were significantly upregulated in chronic Low Back Pain compared with controls. PMID: 28481838
  • antitumor and apoptosis effects of 5-FU are up-regulated by activation of TRPV1 channels, but its action was down-regulated by HPer treatment. It seems that HPer cannot be used for increasing the antitumor effect of 5-FU through modulation of the TRPV1. PMID: 28795251
  • TRPV1 interacts physically with MOR-1 and modulates MOR-1 activity in HEK293 cells. PMID: 29203659
  • the expression of transient receptor potential vanilloid-1 (TRPV1), transient receptor potential vanilloid-2 (TRPV2) and transient receptor potential vanilloid-3 (TRPV3) channels in native human odontoblasts, was examined. PMID: 28905239
  • activation of TRPV1, but not TRPA1 mediates a calcium-dependent cell death. PMID: 29129206
  • Apoptosis and oxidant effects of cisplatin were increased by activation of TRPV1 channels, but its action on the values was further increased by the ALA treatment. Combination therapy of Alpha-lipoic acid and cisplatin could be used as an effective strategy in the treatment of breast cancer. PMID: 28849985
  • Analysis of structural, dynamic, and hydrophobic organization of the pore domain revealed entropy growth upon TRPV1 gating, which is in line with current concepts of thermal sensitivity. PMID: 27612191
  • TRPV5 and TRPV6 lack a positively charged residue in the TM4-TM5 loop that was shown to interact with PI(4,5)P2 in TRPV1, which shows high affinity for this lipid PMID: 27291418
  • SMFAs ubiquitously express functional TRPV1 channels. PMID: 28681979
  • Both TRPV1 and GRP are implied in midbrain physiology of importance to neurological and neuropsychiatric disorders. PMID: 27762319
  • positive correlation between VR1 and PGE2 expression in leiomyoma cells and areas with pain around the tumors PMID: 28026039
  • 5'UTR influences the stability and translation efficacy of TRPV1 transcripts, and that TRPV1 variant three (TRPV1v3) was the most stable and the only variant expressed in glioblastoma samples and in glioma stem-like cells. PMID: 27829230
  • Upper gastrointestinal symptoms are more common in subjects with a higher consumption of spicy foods, younger age and female gender, regardless of TRPV1 genotypes and the H. pylori infection status. PMID: 27094759
  • Mean TRPV-1 and TRPA-1 gene expression was higher in IPF patients compared with controls, but the difference did not reach statistical significance. Immunostaining supported these findings PMID: 29149168
  • TRPV1 and TRPA1 also act as nociceptive sensors and potentiate the inflammatory process. PMID: 28364279
  • studies identified TRPV4 as a channel that contributes to both histamine- and chloroquine-induced itch and indicated that the function of TRPV4 in itch signaling involves TRPV1-mediated facilitation. PMID: 27436359
  • People with the minor alleles of the TRPV1 single nucleotide polymorphisms rs161364 and rs8065080 have a lower risk of diabetes with a high-fat diet, but people with the major alleles are at a higher risk of type 2 diabetes when consuming high-fat diets. PMID: 27287034
  • The TRPV1 transcript was present in prostate cancer-affected foci, both in the tumor tissue as well as in the adjacent untransformed part of the gland. All breast carcinoma cell lines showed robust expression of TRPV1. Trigeminal ganglion expressed significantly higher levels of TRPV1 protein than either breast or prostate cancer cells. Ectopic expression of TRPV1 decreases cancer cell survival by induction of apoptosis. PMID: 27180305
  • This activity is independent of the NGF pathway and is not mediated by known TRPV1 toxins' binding sites. PMID: 28063984
  • It has been shown that the propagation of the TRPV1-induced cytosolic calcium and sodium fluxes into mitochondria is dependent on coordinated activity of NCLX and MCU. PMID: 27627464
  • Endogenous TRPV1 stimulation leads to the activation of the inositol phospholipid pathway necessary for sustained Ca(2+) oscillations. PMID: 27663071
  • The distinct localization of TRPV1 receptor, supports the concept of a role in the functional activity of the trigeminal sensory system. PMID: 27456865
  • This study showed that oleoylethanolamine and palmitoylethanolamine have endogenous roles and potential therapeutic applications in conditions of intestinal hyperpermeability and inflammation. PMID: 27623929
  • The slow sustained current mediated by TRPV1. PMID: 28522561
  • This study suggests that the TRPV1 channel is involved in interferon beta-induced flu-like syndrome in patients with relapsing-remitting multiple sclerosis. PMID: 28284340
  • Respiratory syncytial virus and measles virus infection upregulates TRPV1 expression in bronchial epithelial cells. PMID: 28187208
  • These studies suggest that TRPV1 is expressed on airway smooth muscle. PMID: 28336810
  • mutational analysis of human TRPV1 was performed, and four agonists (capsaicin, RTX, [6]-shogaol and [6]-gingerol) were used to identify amino acid residues involved in ligand binding and/or modulation of proton sensitivity. PMID: 27606946
  • Therefore, and considering the desensitization of TRPV1s in diabetic pancreata, a TRPV1-to-secretagogin regulatory axis seems critical to maintain the structural integrity and signal competence of beta-cells. PMID: 28637794
  • Acute administration of 5-hydroxytryptamine4 (5-HT4) receptor agonist, mosapride or esophageal infusion of the transient receptor potential vanilloid receptor-1 (TRPV1) agonist capsaicin promotes secondary peristalsis.Esophageal infusion with capsaicin-containing red pepper sauce suspension does create greater mechanosensitivity as measured by secondary peristalsis than 5-HT4 receptor agonist mosapride PMID: 27438088
  • Results demonstrated a role of TRPV1 as mediator of sperm thermotaxis in humans. PMID: 27992447
  • There is increased expression of TRPV1 in the rectosigmoid mucosa of diarrhea-predominant irritable bowel syndrome patients. PMID: 27250983
  • TRPV1 expression is upregulated in subjects with sensitive skin, and it correlates with the intensity of the symptoms. Our findings suggest a role for this receptor in the pathogenesis of sensitive skin syndrome. PMID: 26695734
  • Mitogenic responses to EGF and VEGF are mediated through TRPV1 transactivation. Only in hPtEC do the increases in proliferation induced by EGF exceed those in HCjEC. Therefore, TRPV1 is a potential drug target whose clinical relevance in treating pterygium warrants further assessment. PMID: 27163769
  • capsaicin stabilizes the open state of TRPV1 by "pull-and-contact" with the S4-S5 linker. PMID: 28044278
  • REVIEW: role in pain and pain treatment PMID: 27240888
  • By comparing the closed-state molecular dynamics simulations of TRPV1 at 30 degrees C and 60 degrees C, there were observed heat-activated conformational changes in the MPD linker, the outer pore, and the TRP helix that resemble the closed-to-open conformational changes of the protein, along with partial formation of the open-state specific hydrogen bonds. PMID: 27699868
  • These findings suggest that specific molecular interactions control TRPV1 activation by particles, differential activation, and desensitization of TRPV1 by particles and/or other agonists, and cellular changes in the expression of TRPA1 as a result of I585V expression could contribute to variations in asthma symptom control. PMID: 27758864
  • Acidic stimulation increased IL-8 production in LECs, whereas a selective transient receptor potential vanilloid subtype 1 (TRPV1) antagonist, 5'-iodoresiniferatoxin, decreased IL-8 production. PMID: 27312995
  • Activation of TRPV1 with capsaicin attenuates neointimal formation by accelerating re-endothelialization through upregulation of Mfn2. PMID: 26947234
  • Our results have demonstrated that capsaicin and resiniferatoxin form nanomolar complexes with calmodulin, and competitively inhibit TRPV1-calmodulin interaction. These interactions involve the protein recognition interface of calmodulin, which is responsible for all of the cell-regulatory calmodulin-protein interactions. PMID: 27339229
  • In this review, we first describe the chemical and pharmacological properties of capsaicin and its derivatives in relation to their analgesic properties. We then consider the biochemical and functional characteristics of TRPV1, focusing on its distribution and biological effects within the somatosensory and viscerosensory nociceptive systems. PMID: 27322240
  • TRPV1 overexpression attenuates isoproterenolinduced myocardial fibrosis. PMID: 27314441
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed