Recombinant Human Transient Receptor Potential Cation Channel Subfamily A Member 1 (TRPA1) Protein (His-SUMO)

Name: Recombinant Human Transient Receptor Potential Cation Channel Subfamily A Member 1 (TRPA1) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-08194P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Transient Receptor Potential Cation Channel Subfamily A Member 1 (TRPA1) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O75762
Target Symbol	TRPA1
Synonyms	ANKTM 1; ANKTM1; Ankyrin-like with transmembrane domains protein 1; Transformation sensitive protein p120; Transformation-sensitive protein p120; Transient receptor potential cation channel subfamily A member 1; TRPA 1; Trpa1; TRPA1_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
Expression Range	957-1119aa
Protein Length	Partial
Mol. Weight	35.2kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Receptor-activated non-selective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function. Shows 8-fold preference for divalent over monovalent cations. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of irritants, such as allylthiocyanate (AITC) from mustard oil or wasabi, cinnamaldehyde, diallyl disulfide (DADS) from garlic, and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as an ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana. Is activated by a large variety of structurally unrelated electrophilic and non-electrophilic chemical compounds. Electrophilic ligands activate TRPA1 by interacting with critical N-terminal Cys residues in a covalent manner, whereas mechanisms of non-electrophilic ligands are not well determined. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system.
Subcellular Location	Cell membrane; Multi-pass membrane protein.
Protein Families	Transient receptor (TC 1.A.4) family
Database References	HGNC: 497 OMIM: 604775 KEGG: hsa:8989 STRING: 9606.ENSP00000262209 UniGene: Hs.716816
Associated Diseases	Episodic pain syndrome, familial, 1 (FEPS1)
Tissue Specificity	Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells.

Gene Functions References

these results identify a novel AKAP-mediated biochemical mechanism that increases TRPA1 sensitivity in peripheral sensory neurons, and likely contributes to persistent mechanical hypersensitivity. PMID: 28500286
Our findings demonstrate that TRPA1 is a substrate of Cdk5 and that Cdk5 activity is also able to modulate TRPA1 agonist-induced calcium influx and chemo-nociceptive behavioral responses. PMID: 29352128
TRPA1 Modulating C14 Polyacetylenes from the Iranian Endemic Plant Echinophora platyloba. PMID: 30018233
LPS caused the increased functional expression of TRPA1, the activation of which involved in LPS-reduced inflammatory responses in primary human OA-FLS, and the inhibition of TRPA1 produces protective effect in LPS-induced arthritis. PMID: 29318481
Blocking prolyl hydroxylation reveals TRPA1 sensitization to reactive oxygen species (ROS), which enables TRPA1 to convert ROS signalling into cold sensitivity. PMID: 27628562
Data indicate a variant in the transient receptor potential ankyrin A1 channel (TRPA1) gene that selectively cosegregated with cramp-fasciculation syndrome (CFS) in a father-son pair. PMID: 28436534
Peripheral neuronal equivalents (PNEs) exhibited morphological, molecular and functional characteristics of sensory neurons and expressed functional TRPA1 channels. PNE treatment with poly I:C caused similar transient heightened responses to TRPA1 activation compared to untreated cells. PMID: 28931666
These findings provide novel insights into the structure-function relationship of TRPA1 and could lead to the development of more effective analgesics targeted to TRPA1. PMID: 27874100
TRPA1 is involved in nitric oxide-mediated afferent sensory transmission in the clitoris while, in penile erectile tissue, a role for TRPA1 in cholinergic signaling might be assumed. PMID: 28469181
data suggest that the most strictly conserved N-terminal ARs define the energetics of the TRPA1 channel gate and contribute to chemical-, calcium- and voltage-dependence. PMID: 27345869
the heat sensing property of TRPA1 is conserved in mammalians, in which TRPA1 may contribute to sensing warmth and uncomfortable heat in addition to noxious cold. PMID: 27349477
Systemic desensitization through TRPA1 channels by capsazepine and mustard oil - a novel strategy against inflammation and pain. PMID: 27356469
This study reveals a direct binding event and characterizes the role of TRPA1 ankyrin repeats in regulating FGFR2-driven oncogenic process; a mechanism that is hindered by miRNA-142-3p PMID: 29038531
The results obtained with dorsal root ganglia neurons from transient receptor potential cation channel, subfamily A, member 1 channels (TRPA1)-/- mice, TRPM8-/- mice, and wild-type mice, using selective antagonists of TRPA1 and TRPM8 channels, as well as HEK293 cells stably expressing human, TRPA1, indicate that responses to cold, are mediated by TRPA1 channels. PMID: 28408328
TRPA1 gene polymorphisms is associated with childhood asthma PMID: 27779810
TRPM8, but not TRPA1, was detected in freshly isolated native human odontoblasts at the protein and mRNA levels, suggesting that odontoblasts play an important role in detecting external cold stimulation via TRPM8 in healthy condition. PMID: 28043013
neuronal effects of vinca alkaloids require the transient receptor potential ankyrin-1 (TrpA1) channel, and the hypersensitization to painful stimuli in response to the acute exposure to vinca alkaloids is reduced in TrpA1 mutant flies and mice. These findings demonstrate the direct excitation of sensory neurons by CIPN-causing chemotherapy drugs, and identify TrpA1 as an important target during the pathogenesis of CIPN PMID: 29084244
The TRPA1 cation channel was found to be functionally expressed in primary human osteoarthritis chondrocytes, which is an original finding PMID: 27515912
The findings of this study support the notion that epigenetic regulation of TRPA1 seems to regulate thermal and mechanical pain sensitivities. PMID: 28030472
We provided evidence for the extraneuronal presence and upregulation of the proinflammatory TRPA1 receptor in buccal samples of patients with OLP. This may implicate the ion channel in the pathomechanism of OLP. PMID: 27718297
TRPA1 DNA methylation in whole blood cells are associated with pain symptoms in chronic pain patients. PMID: 26849948
Here we highlight the role of TRPA1 as a multipurpose sensor of harmful signals and as a sensor of stress and tissue damage. PMID: 27079970
Three negatively charged amino acids near the outer pore vestibule are involved in heat-evoked TRPA1 activation in the presence of extracellular calcium. PMID: 28194754
These results suggest that IL-1alpha enhances the translocation of TRPA1 to the plasma membrane via the activation of Erk in A549. PMID: 28629997
Respiratory syncytial virus and measles virus infection upregulates TRPA1 expression in bronchial epithelial cells. PMID: 28187208
Protein kinase A is an important kinase acting downstream of inflammatory mediators to cause sensitization of TRPA1. PMID: 28076424
TRPA1 channels are involved in regulating the extent of airway inflammation driven by cystic fibrosis bronchial epithelial cells. PMID: 27281024
The aspartate residue at position 915 represents a constriction site of the TRPA1 pore. PMID: 27824920
data suggest that cardamonin is a selective TRPA1 antagonist, providing novel insight into the target of its anti-nociceptive activity. PMID: 27589700
TRPA1 activation stimulates a cholinergic mechanism in a tetrodotoxin-resistant manner to cause muscle contraction. PMID: 26928772
Taken together, these data demonstrated that TRPA1 activation played an important role in the enhanced production of reactive oxygen species induced by cold stress in A549 cell. PMID: 26634370
Report activation of TRPA1 by o-chlorobenzylidene malononitrile as model of neuropathic pain. PMID: 26046936
TRPA1 was expressed in all studied regions (tongue, epiglottis, and pharynx), but was always localized below the basal lamina. No immunoreactivity for TRPA1 was found on epithelial cells. PMID: 26530852
exposure to cigarette smoke extract initially causes an increase in the extracellular level of ROS, which in turn activates lung epithelial TRPA1 PMID: 26504357
Certain TRPA1 variants and tyrosine-to-phenylalanine mutants exhibited good function compared with non-mutated TRPA1 in transfected HEK293 cells PMID: 26330615
the inflammatory cytokine TNF-a can modulate the activity of the mechanosensitive ion channels TRPA1 and TRPV4 in odontoblasts via the p38 MAPK pathway but has differential effects on their expression. PMID: 26358221
TRPA1 activity may modulate asthma, particularly among individuals living in locations prone to high levels of air pollution. PMID: 26039217
The TRPA1 channel mediates the analgesic action of dipyrone and pyrazolone derivatives PMID: 25765567
Authors propose that inter-subunit salt bridges between adjacent S4-S5 regions are crucial for stabilizing the conformations associated with chemically and voltage-induced gating of the TRPA1 ion channel. PMID: 25724085
It appears that TRPA1 channels may be determinants of airway smooth muscle (ASM) contractility and local inflammation control, positioning them as part of novel mechanisms that control (patho)physiological function of airways and ASM. [Review] PMID: 25654580
Hypothermia mediates its effects on monocytes through TRPA1. PMID: 26054320
The TRPA1 promoter was hypermethylated in individuals with lower pain thresholds, and promoter DNA methylation can downregulate gene expression. PMID: 24496475
carnosol is a new anti-nociceptive agent targeting TRPA1 that can be used to explore further biological role in pain therapy. PMID: 25405290
TRPA1 mrna was increased in the epidermis of itching burn scar patients. PMID: 24695993
Peptide derived from C-terminus of human TRPA1 channel has a strong interaction and affinity with membranes containing anionic lipids. PMID: 25687973
findings indicate that transient receptor potential cationic channel type A1 might be involved in afferent neurotransmission in the vagina and work synergistically together with the nitric oxide/cyclic guanosine monophosphate pathway. PMID: 25056810
Localized TRPA1 channel Ca2+ signals stimulated by reactive oxygen species promote cerebral artery dilation. PMID: 25564678
TRPM8 and TRPA1 assays were inhibited by probenecid. PMID: 24975826
TRPA1 is a major mediator of the proinflammatory/proalgesic actions of aromatase inhibitors PMID: 25484020
TRPA1 is upregulated in colitis and its activation exerts protective roles by decreasing the expressions of several proinflammatory neuropeptides, cytokines and chemokines PMID: 25265225

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.