Recombinant Human Transforming Growth Factor Beta-3 (TGFB3), Active
Beta LifeScience
SKU/CAT #: BLC-05929P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Transforming Growth Factor Beta-3 (TGFB3), Active
Beta LifeScience
SKU/CAT #: BLC-05929P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Transforming Growth Factor Beta-3 (TGFB3), Active is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T-cells is less than 2 ng/ml. |
| Uniprotkb | P10600 |
| Target Symbol | TGFB3 |
| Synonyms | ARVD; ARVD1; FLJ16571; LDS5; MGC105479; MGC118722; prepro-transforming growth factor beta-3; RNHF; TGF beta 3; TGF beta3; TGF-beta-3; TGFB 3; Tgfb3; TGFB3_HUMAN; transforming growth factor beta 3; Transforming growth factor beta-3 |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | Tag-Free |
| Complete Sequence | ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS |
| Expression Range | 301-412aa(Y340F) |
| Protein Length | Partial |
| Mol. Weight | 12.7 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH2.5. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Target Details
| Target Function | Transforming growth factor beta-3 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-3 (TGF-beta-3) chains, which constitute the regulatory and active subunit of TGF-beta-3, respectively.; Required to maintain the Transforming growth factor beta-3 (TGF-beta-3) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-3 and regulates its activation via interaction with 'milieu molecules', such as LTBP1 and LRRC32/GARP, that control activation of TGF-beta-3. Interaction with integrins results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-3.; Transforming growth factor beta-3: Multifunctional protein that regulates embryogenesis and cell differentiation and is required in various processes such as secondary palate development. Activation into mature form follows different steps: following cleavage of the proprotein in the Golgi apparatus, Latency-associated peptide (LAP) and Transforming growth factor beta-3 (TGF-beta-3) chains remain non-covalently linked rendering TGF-beta-3 inactive during storage in extracellular matrix. At the same time, LAP chain interacts with 'milieu molecules', such as LTBP1 and LRRC32/GARP that control activation of TGF-beta-3 and maintain it in a latent state during storage in extracellular milieus. TGF-beta-3 is released from LAP by integrins: integrin-binding results in distortion of the LAP chain and subsequent release of the active TGF-beta-3. Once activated following release of LAP, TGF-beta-3 acts by binding to TGF-beta receptors (TGFBR1 and TGFBR2), which transduce signal. |
| Subcellular Location | [Latency-associated peptide]: Secreted, extracellular space, extracellular matrix.; [Transforming growth factor beta-3]: Secreted. |
| Protein Families | TGF-beta family |
| Database References | HGNC: 11769 OMIM: 107970 KEGG: hsa:7043 STRING: 9606.ENSP00000238682 UniGene: PMID: 30167815 |
