Recombinant Human Transformer-2 Protein Homolog Beta (TRA2B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03404P
Greater than 85% as determined by SDS-PAGE.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TRA2B.
Recombinant Human Transformer-2 Protein Homolog Beta (TRA2B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-03404P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Transformer-2 Protein Homolog Beta (TRA2B) Protein (His-SUMO) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P62995 |
| Target Symbol | TRA2B |
| Synonyms | arginine/serine-rich 10; Arginine/serine-rich splicing factor 10; hTRA2-beta; SFRS10; Splicing factor; Splicing factor arginine/serine rich 10; SRFS10; TRA-2 beta; TRA2-beta; Tra2b; TRA2B_HUMAN; TRAN2B; Transformer 2 beta homolog; Transformer-2 protein homolog B; Transformer-2 protein homolog beta; Transformer-2-beta |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | RANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHT |
| Expression Range | 111-201aa |
| Protein Length | Partial |
| Mol. Weight | 26.5 kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing. Can either activate or suppress exon inclusion. Acts additively with RBMX to promote exon 7 inclusion of the survival motor neuron SMN2. Activates the splicing of MAPT/Tau exon 10. Alters pre-mRNA splicing patterns by antagonizing the effects of splicing regulators, like RBMX. Binds to the AG-rich SE2 domain in the SMN exon 7 RNA. Binds to pre-mRNA. |
| Subcellular Location | Nucleus. |
| Protein Families | Splicing factor SR family |
| Database References | HGNC: 10781 OMIM: 602719 KEGG: hsa:6434 STRING: 9606.ENSP00000416959 UniGene: PMID: 29161765 |
