Recombinant Human Transcriptional Enhancer Factor Tef-3 (TEAD4) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-05029P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Transcriptional Enhancer Factor Tef-3 (TEAD4) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-05029P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Transcriptional Enhancer Factor Tef-3 (TEAD4) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q15561 |
Target Symbol | TEAD4 |
Synonyms | EFTR 2; EFTR2; hRTEF 1B; hRTEF1B; MGC9014; OTTHUMP00000238119; OTTHUMP00000238122; OTTHUMP00000238124; Related to TEF 1; Related to TEF1; Related transcription enhancer factor 1B; RTEF1; TCF13L1; TEA domain family member 4; TEAD 4; TEAD-4; TEAD4; TEAD4_HUMAN; TEF 3; TEF3; TEFR 1; TEFR1; Transcription factor 13 (SV40 transcriptional enhancer factor) like 1; Transcription factor 13 like 1; Transcription factor 13-like 1; Transcription factor RTEF 1; Transcription factor RTEF-1; Transcription factor RTEF1; Transcriptional enhancer factor 1 related; Transcriptional enhancer factor 3; Transcriptional enhancer factor TEF 3; Transcriptional enhancer factor TEF-3; Transcriptional enhancer factor TEF3 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
Expression Range | 74-434aa |
Protein Length | Partial |
Mol. Weight | 67.3 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif. |
Subcellular Location | Nucleus. |
Database References | HGNC: 11717 OMIM: 601714 KEGG: hsa:7004 STRING: 9606.ENSP00000352926 UniGene: PMID: 27291620 |