Recombinant Human Transcription Regulator Protein Bach2 (BACH2) Protein (His)

Name: Recombinant Human Transcription Regulator Protein Bach2 (BACH2) Protein (His)
Brand: Beta LifeScience
SKU: BLC-07447P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Transcription Regulator Protein Bach2 (BACH2) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	Q9BYV9
Target Symbol	BACH2
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	PVDQITDLPRNDFQMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMGELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL
Expression Range	618-770aa
Protein Length	Partial
Mol. Weight	23.5 kDa
Research Area	Cell Biology
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator that acts as repressor or activator. Binds to Maf recognition elements (MARE). Plays an important role in coordinating transcription activation and repression by MAFK. Induces apoptosis in response to oxidative stress through repression of the antiapoptotic factor HMOX1. Positively regulates the nuclear import of actin. Is a key regulator of adaptive immunity, crucial for the maintenance of regulatory T-cell function and B-cell maturation.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	BZIP family, CNC subfamily
Database References	HGNC: 14078 OMIM: 605394 KEGG: hsa:60468 STRING: 9606.ENSP00000257749 UniGene: PMID: 29129929 The epithelial-mesenchymal transition (EMT) pathway was also influenced by miR-130a-3p down-regulation. In conclusion, miR-130a-3p could bind to BACH2, inhibit nasopharyngeal carcinoma cell abilities, and promote cell apoptosis. PMID: 28487475 Ikaros regulates expression of the BCL6/BACH2 axis in acute lymphoblastic leukemia cells. PMID: 28030830 Data show that BACH2 and STAT5B are activated by viral insertions, generating chimeric mRNAs specifically enriched in T regulatory cells favoring their persistence. PMID: 28887441 BACH2 downregulation contributes to constitutive activation of the nuclear factor-kappaB. PMID: 28256087 BACH2 haploinsufficiency causing a syndrome of immune deficiency and autoimmunity is described in two families. Affected subjects had lymphocyte-maturation defects that caused immunoglobulin deficiency and intestinal inflammation. PMID: 28530713 In this study silencing BACH2 in mantle cell lymphoma cells resulted in increased proliferation and enhanced tumor dispersal in hypoxic microenvironments, suggesting a tumor suppressor-like role of BACH2. PMID: 28592433 we developed a CRISPR-Cas9-based tool for specific DNA methylation consisting of deactivated Cas9 (dCas9) nuclease and catalytic domain of the DNA methyltransferase DNMT3A targeted by co-expression of a guide RNA to any 20 bp DNA sequence followed by the NGG trinucleotide.we demonstrated that directed DNA methylation of a wider promoter region of the target loci IL6ST and BACH2 decreased their expression PMID: 26969735 genetic association studies in population in the United Kingdom: Data suggest that an SNP in BACH2 (rs3757247) is associated with autoimmune Addison's disease and with polyglandular autoimmune syndrome type 2. These findings were replicated in a Norwegian validation cohort. PMID: 27680876 The shift in the CSDs by heme binding suggested that heme binding causes Bach2(331-520) to adopt a more compact conformation. In addition, heme binding to the CP-motif could reduce the flexibility of Bach2(331-520) Consequently, the five-coordinated heme binding destabilizes Bach2(331-520), by reducing the flexibility of the polypeptide chain. PMID: 27206783 The study identifies a strong association of Coeliac Disease with a network of BACH2 regulated genes, supporting emerging evidence of an important role of BACH2 in the regulation of T cell differentiation and prevention of autoimmune disease. PMID: 26444573 The investigated Bach2 gene polymorphisms (rs11755527, rs3757247, rs12212193 and rs2474619) are not related to the susceptibility to either Vogt-Koyanagi-Harada syndrome and Behcet's disease in our investigated Chinese Han population. PMID: 25873652 Gene expression analysis revealed that three gene BACH2, PTGER4 and ZFP36L1, are down-regulated in MS patients' blood cells compared to healthy subjects. PMID: 25670004 These observations suggested that the unstructured region of Bach2 is important for heme binding, and consequently for its functional regulation PMID: 25444856 A restored BACH2 expression in BACH2-silenced gastric cancer cell lines, and knockdown of BACH2 using short hairpin RNA (i.e. RNA interference) increased cell proliferation in gastric cancer cells. PMID: 24858026 The type 1 diabetes candidate gene BACH2 regulates proinflammatory cytokine-induced apoptotic pathways in pancreatic beta-cells by crosstalk with another candidate gene, PTPN2, and activation of JNK1 and BIM. PMID: 24608439 The dynamics of Bach2 expression in response to DNA damage shows that it is a highly sensitive responder to transcription-blocking DNA lesions. PMID: 24075570 BACH2 expression level is a promising predictor of prognosis for diffuse large B cell lymphoma. PMID: 24450488 Our study clearly demonstrated that BACH2 is a susceptibility gene for GD in the Chinese Han population PMID: 24346624 Lower levels of BACH2 is associated with drug resistance in mantle cell lymphoma. PMID: 23936317 our data suggest that BACH2 may play an essential role for somatic hypermutation of the Ig gene in B-cell lymphoma PMID: 23865571 This study provides robust evidence for an association of rheumatoid arthritis susceptibility with genes involved in B cell differentiation (BACH2) and DNA repair (RAD51B). PMID: 24022229 BACH2 competes with BCL6 for promoter binding and reverses BCL6-mediated repression of p53 and other cell cycle checkpoint-control genes. PMID: 23852341 Downregulation of BACH2 mediated by Bcr-Abl oncoprotein via PAX5 is associated with chronic myeloid leukaemia. PMID: 22858985 crystal structure of the human Bach2 POZ domain is reported at 2.1 A resolution PMID: 22194330 This is the first report that shows the involvement of both BCL2L1 and the transcription factor BACH2 in a chromosomal rearrangement. PMID: 21412927 BACH2 is transcriptionally regulated by the BCR/ABL oncogene. PMID: 11746976 antineoplastic drugs that were oxidative stressors induced the nuclear accumulation of BACH2 PMID: 12829606 loss of BACH2 expression through Epstein-Barr virus integration might contribute to lymphomagenesis PMID: 14982850 Results demonstrate that transcription activity associated with PML bodies is selectively repressed by the recruitment of Bach2 around PML bodies. PMID: 15060166 Upregulation of BACH2 is associated with ovarian cancer PMID: 16832351 Bach2 is phosphorylated on S521 via Bcr-Abl signaling thru the phosphatidylinositol-3/S6 kinase pathway,and transcriptionally represses heme oxygenase-1 PMID: 17018862 down-regulation of the BACH2 gene through the interaction with centromeric heterochromatin would take part in leukomogenesis of BCR-ABL positive lymphoid leukemia. PMID: 17044046 This study demonstrated strong integration clusters in the BACH2 gene were observed in 2 HIV infection patients without detectable viremia. PMID: 17262715 expression of the silencing mediator of retinoid and thyroid receptor (SMRT) & histone deacetylase4 (HDAC4) enhances formation of Bach2 foci in nuclear matrix. SMRT mediates HDAC4 binding to Bach2, & HDAC4 facilitates the retention of Bach2 in the foci. PMID: 17383980 This study demonstrates a novel role for Bach2 as a key regulator of nucleic acid-triggered antiviral responses in human cells. PMID: 17991429 reporter assays demonstrated that Bach2 and Bcl6 cooperate to repress Prdm1 through its intron enhancer region PMID: 18256039 BACH2 expression is necessary to maintain IL-2 production when NFAT1 protein is reduced, potentially impacting umbilical cord blood graft CD4(+) T-cell allogeneic responses PMID: 18769450 BACH2 may be partially responsible for regulation of BCL2 expression from the t(14;18)(q21;q34) translocation PMID: 18929412

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.