Recombinant Human Transcription Intermediary Factor 1-Alpha (TRIM24) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10715P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Transcription Intermediary Factor 1-Alpha (TRIM24) Protein (His)

Beta LifeScience SKU/CAT #: BLC-10715P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Transcription Intermediary Factor 1-Alpha (TRIM24) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O15164
Target Symbol TRIM24
Synonyms E3 ubiquitin protein ligase TRIM24; E3 ubiquitin-protein ligase Trim24; hTIF1; PTC6; RING finger protein 82; RNF82; TF1A; TIF1 alpha; TIF1; TIF1-alpha; TIF1A; TIF1A_HUMAN; TIF1ALPHA; Transcription intermediary factor 1-alpha; Transcriptional intermediary factor 1 alpha; Transcriptional intermediary factor 1; Trim24; Tripartite motif containing 24; Tripartite motif-containing protein 24
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
Expression Range 891-1012aa
Protein Length Partial
Mol. Weight 16.5kDa
Research Area Epigenetics And Nuclear Signaling
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes.
Subcellular Location Nucleus. Cytoplasm. Note=Colocalizes with sites of active transcription. Detected both in nucleus and cytoplasm in some breast cancer samples. Predominantly nuclear.
Database References

HGNC: 11812

OMIM: 603406

KEGG: hsa:8805

STRING: 9606.ENSP00000340507

UniGene: PMID: 29749443

  • TRIM24 is upregulated in HNSCC and promotes HNSCC cell growth and invasion through modulation of cell cycle, glucose metabolism, and GLUT3, making TRIM24 a potential oncoprotein in HNSCC. PMID: 29862279
  • The findings identify TRIM24 as an oncogenic transcriptional co-activator in epidermal growth factor receptor-driven glioblastoma and also demonstrate a previously unknown signal relay by which H3K23ac/TRIM24 mediates epidermal growth factor receptor stimulation of STAT3 activation, thereby enhancing the oncogenic activity of the epidermal growth factor receptor/STAT3 pathway in human cancers. PMID: 29129908
  • Results suggest that TRIM24 is a novel coactivator of the CAR that is involved in cell- and/or promoter- selective transactivation. PMID: 29101097
  • TRIM24 expression was increased in human colorectal cancer and might be a novel prognostic biomarker. PMID: 28916426
  • Study showed that TRIM24 was upregulated during gastric carcinogenesis and demonstrated that TRIM24 was a functional target gene of miR-511, and miR-511 inactivated PI3K/AKT and Wnt/beta-catenin pathways by suppressing TRIM24. PMID: 28114950
  • we identified altered glucose metabolism in the progression of head and neck squamous cell carcinoma and showed that it could be partially attributed to the novel link between GLUT4 and TRIM24 PMID: 28061796
  • This study concluded that reduced TRIM24 protein is associated with poor survival in esophageal squamous cell cancer (ESCC) patients, suggesting TRIM24 protein is a potential prognostic biomarker for ESCC. PMID: 27689360
  • Data suggest that, in cardiomyocytes, TRIM32 attenuates activation of SRF signaling and hypertrophy due to dysbindin; TRIM24 promotes these effects. TRIM32 promotes dysbindin degradation; TRIM24 protects dysbindin from degradation. (TRIM = tripartite motif-containing protein; SRF = serum response factor) PMID: 28465353
  • hypothesis of "synergistic modification induced recognition" is then proposed to link histone modification and TRIM24 binding PMID: 27079666
  • Report provides evidence for an oncogenic role for TRIM24 as a transcriptional activator and mediator of hormone-refractory prostate cancer cell growth in SPOP mutant and castration-resistant prostate cells. PMID: 27238081
  • TRIM24 expression is positively correlated with Acetylated H3 lysine 23 levels, and high levels of both TRIM24 and Acetylated H3 lysine 23 predict shorter overall survival of breast cancer patients. PMID: 27638829
  • TRIM24 regulate resistance to Gefitinib via Akt pathway in non-small cell lung cancer cells. PMID: 26805734
  • TRIM24 is overexpressed in human bladder cancer and facilitates bladder cancer growth and invasion, possibly through NF-kappaB and AKT signaling pathways. PMID: 25846736
  • functions as an oncogene in colorectal carcinogenesis PMID: 25700357
  • A role for TRIM24 in breast tumorigenesis through reprogramming of glucose metabolism in human mammary epithelial cells, further supporting TRIM24 as a viable therapeutic target in breast cancer. PMID: 25065590
  • our study shows that TRIM24 is overexpressed in human gastric cancer and accelerates cell growth as well as induce chemoresistance PMID: 25724180
  • Our results suggest that TRIM24 might serve as a potential prognostic marker and therapeutic target for the management of malignant gliomas. PMID: 24469053
  • Study shows that TRIM24 is destabilized by ATM-mediated phosphorylation of TRIM24S768 in response to DNA damage, which disrupts TRIM24-p53 interactions and promotes the degradation of TRIM24. PMID: 24820418
  • Overexpression of TRIM24 is associated with the onset and progress of human hepatocellular carcinoma. PMID: 24409330
  • Upon TRIM24 silencing, the proliferation of HNSCC cells was notably inhibited due to the induction of apoptosis. PMID: 23717505
  • TRIM24 plays an important role in NSCLC progression PMID: 22666376
  • These results suggest that E4-ORF3 targets proteins for relocalization through a loosely homologous sequence dependent on accessibility. PMID: 22123502
  • overexpression of the TRIM24/TIF-1alpha gene in breast cancer is associated with poor prognosis and worse surviva PMID: 21435435
  • Aberrant expression of TRIM24 negatively correlates with survival of breast cancer patients. PMID: 21164480
  • TRIM24 regulates AR-mediated transcription in collaboration with TIP60 and BRD7. PMID: 19909775
  • Preferential expression of the HTIF1alpha gene in acute myeloid leukemia and MDS-related AML. Could play a role in myeloid differentiation, being distinctly regulated in hematopoietic lineages. PMID: 11986951
  • TIF1alpha interacts with TIF1gamma and the coiled-coil region of TIF1gamma is necessary for this interaction. PMID: 12096914
  • We propose that ZCCHC11 is a unique TLR signal regulator, which interacts with TIFA after LPS treatment and suppresses the TRAF6-dependent activation of NF-kappaB. PMID: 16643855
  • We identified a novel interaction between E4 ORF3 and TIF1alpha PMID: 17287283
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed