Recombinant Human Transcription Initiation Factor Iia Subunit 2 (GTF2A2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09221P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Transcription Initiation Factor Iia Subunit 2 (GTF2A2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09221P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Transcription Initiation Factor Iia Subunit 2 (GTF2A2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P52657 |
Target Symbol | GTF2A2 |
Synonyms | General transcription factor IIA; General transcription factor IIA subunit 2; General transcription factor IIA; 2 (12kD subunit); General transcription factor IIA; 2; 12kDa; gtf2a2; HsT18745; T2AG_HUMAN; TF2A2; TFIIA 12; TFIIA; TFIIA gamma ; TFIIA p12 subunit; TFIIA-12; TFIIA-gamma; TFIIA12; TFIIAS; Transcription initiation factor IIA gamma chain; Transcription initiation factor IIA subunit 2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE |
Expression Range | 1-109aa |
Protein Length | Full Length |
Mol. Weight | 39.5kDa |
Research Area | Epigenetics And Nuclear Signaling |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity. |
Subcellular Location | Nucleus. |
Protein Families | TFIIA subunit 2 family |
Database References |